Preparing your result...
Loading...
Press Esc to dismiss this message

Influenza virus vaccine composition and methods of use (26-May-2009)

Thumbnail
US Patent Publication (Source: USPTO)
Publication No. US 7537768 B2 published on 26-May-2009
Application No. US 11/704251 filed on 09-Feb-2007
Abstract (English)
The present invention is directed to enhancing the immune response of a human in need of protection against IV infection by administering in vivo, into a tissue of the human, at least one polynucleotide comprising one or more regions of nucleic acid encoding an IV protein or a fragment, a variant, or a derivative thereof. The present invention is further directed to enhancing the immune response of a human in need of protection against IV infection by administering, in vivo, into a tissue of the human, at least one IV protein or a fragment, a variant, or derivative thereof. The IV protein can be, for example, in purified form or can be an inactivated IV, such as those present in inactivated IV vaccines. The polynucleotide is incorporated into the cells of the human in vivo, and an immunologically effective amount of an immunogenic epitope of an IV, or a fragment, variant, or derivative thereof is produced in vivo. The IV protein (in purified form or in the form of an inactivated IV vaccine) is also administered in an immunologically effective amount.
Inventors/Applicants
Luke, Catherine J. [+5] [-5]
Frederick, MD, US
Vilalta, Adrian
San Diego, CA, US
Wloch, Mary K.
San Diego, CA, US
Evans, Thomas G.
Cambridge, MA, US
Geall, Andrew J.
Littleton, MA, US
Jimenez, Gretchen S.
San Diego, CA, US
Assignees
Vical Incorporated
San Diego, CA, US
Classifications
International (2006.01): A61K 39/145; C07K 14/11
National: 424/186.1; 424/209.1; 435/235.1; 530/350
Field of Search: Non/e
Patent References
US 4683195 A Process for amplifying, detecting, and/or-cloning nucleic acid sequences Jul-1987
US 4816567 A Recombinant immunoglobin preparations Mar-1989
US 4818527 A T cell epitopes of the hepatitis B virus nucleocapsid protein Apr-1989 [+42] [-42]
US 4882145 A T cell epitopes of the hepatitis B virus nucleocapsid protein Nov-1989
US 5143726 A T cell epitopes of the hepatitis B virus nucleocapsid protein Sep-1992
US 5264618 A Cationic lipids for intracellular delivery of biologically active molecules Nov-1993
US 5561064 A Production of pharmaceutical-grade plasmid DNA Oct-1996
US 5580859 A Delivery of exogenous DNA sequences in a mammal Dec-1996
US 5591631 A Anthrax toxin fusion proteins, nucleic acid encoding same Jan-1997
US 5656611 A Polynucleotide compositions Aug-1997
US 5837693 A Intravenous hormone polypeptide delivery by salivary gland expression Nov-1998
US 6004944 A Protein delivery by secretory gland expression Dec-1999
US 6207646 B1 Immunostimulatory nucleic acid molecules Mar-2001
US 6214804 B1 Induction of a protective immune response in a mammal by injecting a DNA sequence Apr-2001
US 6231864 B1 Strategically modified hepatitis B core proteins and their derivatives May-2001
US 6406705 B1 Use of nucleic acids containing unmethylated CpG dinucleotide as an adjuvant Jun-2002
US 6429199 B1 Immunostimulatory nucleic acid molecules for activating dendritic cells Aug-2002
US 6500432 B1 Method to enhance an immune response of nucleic acid vaccination Dec-2002
US 6867195 B1 Lipid-mediated polynucleotide administration to reduce likelihood of subject's becoming infected Mar-2005
US 6875748 B2 Compositions and methods for in vivo delivery of polynucleotide-based therapeutics Apr-2005
US 7105574 B1 Adjuvant compositions and methods for enhancing immune responses to polynucleotide-based vaccines Sep-2006
US 7250404 B2 Lipid-mediated polynucleotide administration to deliver a biologically active peptide and to induce a cellular immune response Jul-2007
US 2002/0165172 A1 Compositions and methods for treating intracellular diseases Nov-2002
US 2003/0032615 A1 Lipid-mediated polynucleotide administration to deliver a biologically active peptide and to induce a cellular immune response Feb-2003
US 2003/0191082 A1 Adjuvant compositions and methods for enhancing immune responses to polynucleotide-based vaccines Oct-2003
US 2003/0202982 A1 Influenza immunogen and vaccine Oct-2003 424/189.1
US 2004/0023911 A1 Expression of exogenous polynucleotide sequences in a vertebrate Feb-2004
US 2004/0157244 A1 Process for purification of plasmid DNA Aug-2004
US 2004/0157789 A1 Method for freeze-drying nucleic acid/block copolymer/cationic surfactant complexes Aug-2004
US 2004/0162256 A1 Method for producing sterile polynucleotide based medicaments Aug-2004
US 2004/0171572 A1 Complex cationic lipids having quaternary nitrogens therein Sep-2004
US 2006/0024670 A1 Influenza virus vaccine composition and methods of use Feb-2006
CA 2025598 C Chimaeric hepadnavirus core antigen proteins Mar-1991
EP 0173494 A2 Chimeric receptors by DNA splicing and expression. Mar-1986
EP 0171496 B1 Process for the production of a chimera monoclonal antibody May-1993
EP 0385610 B1 Conjugates Mar-1994
EP 0421635 B1 Chimaeric hepadnavirus core antigen proteins Jul-1995
WO 86/01533 A1 Mar-1986
WO 87/02671 A1 May-1987
WO 94/21797 A1 Sep-1994
WO 99/40934 A1 Aug-1999
WO 00/57917 A2 Oct-2000
WO 01/83528 A2 Nov-2001
WO 02/00844 A2 Jan-2002
WO 02/24876 A2 Mar-2002
Other References
Heinen et al (Journal of General Virology 83:1851-1859, 2002). [+110] [-110]
Aihara, H. and Miyazaki J.-I., “Gene transfer into muscle by electroporation in vivo,” Nat. Biotechnol. 16:867-870, Nature America, Inc. (1998).
Attal, J., et al., “The RU5 (‘R’) region from human leukaemia viruses (HTLV-1) contains an internal ribosome entry site (IRES)-like sequence,” FEBS Letters 392:220-224, Elsevier Science B.V. (1996).
Berendt, R.F., and Hall, W.C., “Reaction of Squirrel Monkeys to Intratrachael Inoculation with Influenca/A/New Jersey/76 (Swine) Virus,” Infect. Immun. 16:476-479, American Society for Microbiology (1977).
Billaut-Mulot, O., et al., “Interleukin-18 modulates immune responses induced by HIV-1 Nef DNA prime/protein boost vaccine,” Vaccine 19:95-102, Elsevier Science Ltd. (2001).
Boulianne, G.L., et al., “Production of functional chimaeric mouse/human antibody,” Nature 312:643-646, Macmillan Journals Ltd. (1984).
Chen, Z.-Y., et al., “Linear DNAs Concatermerize in Vivo and Result in Sustained Transgene Expression in Mouse Live,” Mol. Ther. 3:403-410, Academic Press (2001).
Cherng, J.-Y., et al., “Effect of DNA topology on the transfection efficiency of poly((2-dimethylamino)ethyl methacrylate)-plasmid complexes,” J. Control. Release 60:343-353, Elsevier Science B.V. (1999).
Clarke, B.E., et al., “Improved immunogenicity of a peptide epitope after fusion to hepatitis B core protein,” Nature 330:381-384, Macmillan Magazines Ltd. (1987).
Collins, P.L., et al., “Respiratory Syncytial Virus,” in Field's Virology, 4th Edition, Knipe, D.M., et al., eds., Lipponcott Williams & Wilkins, Chapter 45, pp. 1464-1465 (2001).
Colucci, G., et al., “Identification of a Major Hepatitis B Core Antigen (HBcAg) Determinant by Using Synthetic Peptides and Monoclonal Antibodies,” J. Immunol. 141:4376-4380, The American Association of Immunologists (1988).
Crasto, C.J. and Feng, J.-A., “Linker: a program to generate linker sequences for fusion proteins,” Protein Eng. 13:309-312, Oxford University Press (2000).
Darquet, A.-M., et al., “A new DNA vehicle for nonviral gene delivery: supercoiled minicircle,” Gene Therapy 4:1341-1349, Stockton Press (1997).
Davis, H.L., et al., “Direct gene transfer in skeletal muscle: plasmid DNA-based immunization against the hepatitis B virus surface antigen,” Vaccine 12:1503-1509, Butterworth-Heinemann Ltd. (1994).
Donnelly, J.J., et al., “DNA Vaccines,” Annu. Rev. Immunol. 15:617-648, Annual Reviews Inc. (1997).
Felgner, P.L., et al., “Lipofection: A highly efficient, lipid-mediated DNA-transfection procedure,” Proc. Natl. Acad. Sci. USA 84:7413-7417, The National Academy of Sciences (1987).
Fischer, W.B., and Sansom, M.S., “Viral ion channels: structure and function,” Biochim. Biophys. Acta 1561:27-45, Elsevier Science B.V. (2002)
Galibert, F., et al., “Nucleotide sequence of the hepatitis B virus genome (subtype ayw) cloned in E. coli,” Nature 281:646-650, Macmillan Journals Ltd. (1979).
Gao, X., and Huang, L., “Potentiation of Cationic Liposome-Mediated Gene Delivery by Polycations,” Biochemistry 35:1027-1036, American Chemical Society (1996).
Gilbert, S.C., et al., “Enhanced CD8 T cell immunogenicity and protective efficacy in a mouse malaria model using a recombinant adenoviral vaccine in heterologous prime-boost immunisation regimes,” Vaccine 20:1039-1045, Elsevier Science Ltd. (2002).
Goff, S.P., “Retroviridae: The Retroviruses and Their Replication,” in Field's Virology, 4th Edition, Knipe, D.M., et al., eds., Lipponcott Williams & Wilkins, Chapter 57, pp. 1871-1939 (2001).
Gonzalo, R.M., et al., “A heterologous prime-boost regime using DNA and recombinant vaccinia virus expression the Leishmania infantum P36/LACK antigen protects BALB/c mice from cutaneous leishmaniasis,” Vaccine 20:1226-1231, Elsevier Science Ltd. (2002).
Graham, F.L., and Van Der Eb, A.J., “A New Technique for the Assay of Infectivity of Human Adenovirus 5 DNA,” Virology 52:456-467, Academic Press, Inc. (1973).
Gramzinski, R.A., et al., “Immune Response to a Hepatitis B DNA Vaccine in Aotus Monkeys: A Comparison of Vaccine Formulation, Route, and Method of Administration,” Mol. Med. 4:109-118, The Picower Institute Press (1998).
National Research Council, Guide for the Care and Use of Laboratory Animals, National Academy Press, Washington, D.C. (1996).
Macken, C., et al., “The value of a database in surveillance and vaccine selection,” in Options for the Control of Influenza IV, Osterhaus, A.D.M.E., et al., eds., Elsevier Science B.V., Amsterdam, pp. 103-106 (2001).
Hartikka, J., et al., “Vaxfectin enhances the humoral immune response to plasmid DNA-encoded antigens,” Vaccine 19:1911-1923, Elsevier Science Ltd. (2001).
Hartikka, J., et al., “Electroporation-Facilitated Delivery of Plasmid DNA in Skeletal Muscle: Plasmid Dependence of Muscle Damage and Effect of Poloxamer 188,” Mol Ther 4:407-415, Academic Press (2001).
Hartikka, J., et al., “An Improved Plasmid DNA Expression Vector for Direct Injection into Skeletal Muscle,” Hum. Gene Ther. 7:1205-1217, Mary Ann Liebert, Inc. (1996).
Heinen, P.P., et al., “Vaccination of pigs with a DNA construct expressing an influenza virus M2-nucleoprotein fusion protein exacerbates disease after challenge with influenza A virus,” J. Gen. Virol. 83:1851-1859, Society for General Microbiology (2002).
Horn, N.A., et al., “Cancer Gene Therapy Using Plasmid DNA: Purification of DNA for Human Clinical Trials,” Hum. Gene Ther. 6:565-573, Mary Ann Liebert, Inc. (1995).
Ito, T., et al., “Evolutionary Analysis of the Influenza A Virus M Gene with Comparison of the M1 and M2 Proteins,” J. Virol. 65:5491-5498, American Society for Microbiology (1991).
Jung, J., et al., “Distinct Response of Human B cell Subpopulations in Recognition of an Innate Immune Signal, CpG DNA,” J. Immunol. 169:2368-2373, The American Association of Immunologists, Inc. (2002).
Klinman, D.M., et al., “CpG motifs present in bacterial DNA rapidly induce lymphocytes to secrete interleukin 6, interleukin 12, and interferon γ,” Proc. Natl Acad. Sci. USA 93:2879-2883, The National Academy of Sciences (1996).
Kodihalli, S., et al., “Strategies for inducing protection against avian influenza A virus subtypes with DNA vaccines,” Vaccine 18:2592-2599, Elsevier Science Ltd. (2000).
Köhler, G., et al., “Fusion between immunoglobulin-secreting and nonsecreting myeloma cell lines,” Eur. J. Immunol. 6:292-295, Verlag Chemie, GmbH and Academic Press Inc. (1976).
Köhler, G., and Milstein, C., “Derivation of specific antibody-producing tissue culture and tumor lines by cell fusion,” Eur. J. Immunol. 6:511-519, Verlag Chemie, GmbH and Academic Press Inc. (1976).
Köhler, G., and Milstein, C., “Continuous cultures of fused cells secreting antibody of predefined specificity,” Nature 256:495-497, Macmillan Journals Ltd. (1975).
Lamb, R.A., and Lai, C.-J., “Conservation of the Influenza Virus Membrane Protein (M1) Amino Acid Sequence and an Open Reading Frame of RNA Segment 7 Encoding a Second Protein (M2) in H1N1 and H3N2 Strains,” Virology 112:746-751, Academic Press, Inc. (1981).
Lamb, R.A., et al., “Influenza Virus M2 Protein Is an Integral Membrane Protein Expressed on the Infected-Cell Surface,” Cell 40:627-633, The MIT Press (1985).
Lindmayer, I., et al., “Development of New Jet Injector for Insulin Therapy,” Diabetes Care 9:294-297, American Diabetes Association, Inc. (1986).
Manickan, E., et al., “DNA Vaccines—A Modern Gimmick of a Boon to Vaccinology?” Crit. Rev. Immunol. 17:139-154, Begell House, Inc. (1997).
Martins, J.K., and Roedl, E.A., “Medijector—A New Metho of Corticosteroid-Anesthetic Delivery,” J. Occup. Med. 21:821-824, Oxford University Press (1979).
Mathiesen, I., “Electropermeabilization of skeletal muscle enhances gene transfer in vivo,” Gene Ther. 6:508-514, Stockton Press (1999).
Mir, L.M., et al., “High-efficiency gene transfer into skeletal muscle mediated by electric pulses,” Proc. Natl. Acad. Sci. USA 96:4262-4267, The National Academy of Sciences (1999).
Morrison, S.L., “Transfectomas Provide Novel Chimeric Antibodies,” Science 229:1202-1207, American Association for the Advancement of Science (1985).
Nakamura, Y., et al., “Codon usage tabulated from international DNA sequence databases: status for the year 2000,” Nucl. Acids Res. 28:292, Oxford University Press (2000).
Nassal, M., “Total chemical synthesis of a gene for hepatitis B virus core protein and its functional characterization,” Gene 66:279-294, Elsevier Science Publishers B.V. (1988).
Neirynck, S., et al., “A universal influenza A vaccine based on the extracellular domain of the M2 protein,” Nat. Med. 5:1157-1163, Nature America, Inc. (1999).
Neuberger, M.S., et al., “A hapten-specific chimaeric IgE antibody with human physiological effector function,” Nature 314:268-270, Macmillan Journals Ltd. (1985).
Nossal, G., “Living up to the legacy,” Nat. Med. 4(Vaccine Suppl.):475-476, Nature America, Inc. (1998).
Oi, V.T., and Morrison, S.L., “Chimeric Antibodies,” BioTechniques 4:214-221, Eaton Publishing Co. (1986).
Okuda, K., et al., “Protective immunity against influenza A virus induced by immunization with DNA plasmid containing influenza M gene,” Vaccine 19:3681-3691, Elsevier Science Ltd. (2001).
Qin, Y.-J., et al., “Gene Suture—A Novel Method for Intramuscular Gene Transfer and Its Application in Hypertension Therapy,” Life Sciences 65: 2193-2203, Elsevier Science Inc. (1999).
Rizzuto, G., et al., “Gene Electrotransfer Results in a High-Level Transduction of Rat Skeletal Muscle and Corrects Anemia of Renal Failure,” Hum. Gen. Ther. 11:1891-1900, Mary Ann Liebert, Inc. (2000).
Robinson, H.L., “New Hope for An AIDS Vaccines,” Nat. Rev. Immunol. 2:239-250, Nature Publishing Group (2002).
Salfeld, J., et al. “Antigenic Determinants and Functional Domains in Core Antigen and e Antigen from Hepatitis B Virus,” J. Virol. 63:798-808, American Society for Microbiology (1989).
Sankar, V., et al., “Salivary gland delivery of pDNA-cationic lipoplexes elicits systemic immune responses,” Oral Diseases 8:275-281, Blackwell Munksgaard (2002).
Schneider, J., et al., “Induction of CD8+ T cells using heterologous prime-boost immunisation strategies,” Immunol. Rev. 170:29-38, Munksgaard Inetrnational Publishers Ltd. (1999).
Schrijver, R.S., et al., “Immunization of cattle with a BHV1 vector vaccine of a DNA vaccine both coding for the G protein of BRSV,” Vaccine 15:1908-1916, Elsevier Science Ltd. (1997).
Shiver, J.W., et al., “Replication-incompetent adenoviral vaccine vector elicits effective anti-immunodeficiency-virus immunity,” Nature 415:331-335, Nature Publishing Group (2002).
Shu, L.L., et al., “Analysis of the Evolution and Variation of the Human Influenza A Virus Nucleoprotein Gene from 1933 to 1990,” J. Virol. 67:2723-2729, American Society for Microbiology (1993).
Sin, J.-I., et al., “DNA Priming-Protein Boosting Enhances Both Antigen-Specific Antibody and Th1-Type Cellular Immune Responses in a Murine Herpes Simplex Virus-2 gD Vaccine Model,” DNA Cell Biol. 18:771-779, Mary Ann Liebert, Inc. (1999).
Slepushkin, V.A., et al., “Protection of mice against influenza A virus challenge by vaccination with baculovirus-expressed M2 protein,” Vaccine 13:1399-1402, Elsevier Science Ltd. (1995).
Stahl, S.J., and Murray, K., “Immunogenicity of peptide fusions to hepatitis B virus core antigen,” Proc. Natl. Acd. Sci. USA, 86:6283-6287, The National Academy of Sciences (1989).
Subbarao, K., “Influenza Vaccines: Present and Future,” Advances in Virus Research 54:349-373, Academic Press (1999).
Sutcliffe, J.G., et al., “Antibodies That React with Predetermined Sites on Proteins,” Science 219:660-666, American Association for the Advancement of Science (1983).
Takebe, Y., et al., “SRα Promoter: an Efficient and Versatile Mammalian cDNA Expression System Composed of the Simian Virus 40 Early Promoter and the R-U5 Segment of Human T-Cell Leukemia Virus Type 1 Long Terminal Repeat,” Mol. Cell Biol. 8:466-472, American Society for Microbiology (1988).
Tanghe, A., “Improved Immunogenicity and Protective Efficacy of a Tuberculosis DNA Vaccine Encoding Ag85 by Protein Boosting,” Infect. Immun. 69:3041-3047, American Society for Microbiology (2001).
Toncheva, V., et al., “Novel vectors for gene delivery formed by self-assembly of DNA with poly(L-lysine) grafted with hydrophilic polymers,” Biochim. Biophys. Acta 1380:354-368, Elsevier Science B.V. (1998).
Treanor, J.J., et al., “Passively Transferred Monoclonal Antibody to the M2 Protein Inhibits Influenza A Virus Replication in Mice,” J. Virol. 64:1375-1377, American Society for Microbiology (1990).
Trubetskoy, V.S., et al., “Cationic liposomes enhance targeted delivery and expression of exogenous DNA mediated by N-terminal modified poly(L-lysine)-antibody conjugate in mouse lung endothelial cells,” Biochem. Biophys. Acta 1131:311-313, Elsevier Science Publishers B.V. (1992).
Ulmer, J.B., et al., “Protective CD4+ and CD8+ T cells against Influenza Virus Induced by Vaccination with Nucleoprotein DNA,” J Virol. 72:5648-5653, American Society for Microbiology (1998).
Ulmer, J.B., et al., “Heterologous Protection Against Influenza by Injection of DNA Encoding a Viral Protein,” Science 259:1745-1749, American Association for the Advancement of Science (1993).
Vahlsing, H.L., et al., “Immunization with plasmid DNA using a pneumatic gun,” J. Immunol. Methods 175:11-22, Elsevier Science B.V. (1994).
Wagner, H., “Interactions between bacterial CpG-DNA and TLR9 bridge innate and adaptive immunity,” Curr. Opin. Microbiol. 5:62-69, Elsevier Science Ltd. (2002).
Wands, J.R., and Zurawski, Jr., V.R., “High Affinity Monoclonal Antibodies to Hepatitis B Surface Antigen (HBsAg) Produced by Somatic Cell Hybrids,” Gastroenterology 80:225-232, Elsevier North-Holland, Inc. (1981).
Watabe, S., et al., “Protection against influenza virus challenge by topical application of influenza DNA vaccine,” Vaccine 19:4434-4444, Elsevier Science Ltd. (2001).
Wheeler, C.J., et al., “Converting an alcohol to an amine in a cationic lipid dramatically alters the co-lipid requirement, cellular transfection activity and the ultrastructure of DNA-cytofectin complexes,” Biochim. Biophys. Acta 1280:1-11, Elsevier Science B.V. (1996).
Wheeler, C.J., et al., “A novel cationic lipid greatly enhances plasmid DNA delivery and expression in mouse lung,” Proc. Natl. Acad. Sci. USA 93:11454-11459, The National Academy of Sciences (1996).
Widera, G., et al, “Increased DNA Vaccine Delivery and Immunogenicity by Electroporation In Vivo,” J. Immunol. 164:4635-4640, The American Association of Immunologists (2000).
Yang, Z.-Y., et al. “Overcoming Immunity to a Viral Vaccine by DNA Priming before Vector Boosting,” J. Virol. 77:799-803, American Society for Microbiology (2003).
Yanisch-Perron, C., et al. “Improved M13 phage cloning vectors and host strais: nucleotide sequences of the M13mp18 and pUC19 vectors,” Gene 33:103-119, Elsevier Science Publishers (1985).
Zhong, Q., et al., “The M2 channel of influenza A virus: a molecular dynamics study,” FEBS Lett. 434:265-271, Elsevier Science B.V. (1998).
NCBI Entrez, GenBank Report, Accession No. K01395 (Entry date 1993).
NCBI Entrez, GenBank Report, Accession No. AF046098 (Entry date 1998).
NCBI Entrez, GenBank Report, Accession No. AF116576 (Entry date 1999).
NCBI Entrez, GenBank Report, Accession No. AF202541 (Entry date 1999).
NCBI Entrez, GenBank Report, Accession No. AF389121 (Entry date 2001).
NCBI Entrez, GenBank Report, Accession No. AJ404626 (Entry date 2000).
NCBI Entrez, GenBank Report, Accession No. M38279 (Entry date 1993).
Co-pending U.S. Appl. No. 60/681,975, inventors Hermanson, G., et al., filed May 18, 2005.
“Codon Usage Database” maintained by Kazusa DNA Research Institute, 1 page, available at http://www.kazusa.or.jp/codon/ (visited Jul. 9, 2002).
Mozdzanowska, K., et al., “Induction of influenza type A virus-specific resistance by immunization of mice with a synthetic multiple antigenic peptide vaccine that contains ectodomains of matrix protein 2,” Vaccine 21:2616-2626, Elsevier Science (Jun. 2003).
Koide, Y., et al., “DNA vaccines,” Jpn. J. Pharmacol. 83:167-174, Japanese Pharmacological Society (Jul. 2000).
NCBI Entrez, GenBank Report, Accession No. CAD30535, Gregory, V., et al. (first entered Sep. 2002, last updated Nov. 2006).
NCBI Entrez, GenBank Report, Accession No. AAA19192, Klimov,A.I., et al., (first entered 1993, last updated Jun. 2006).
Bender, B.S., et al., “Immunogenicity and efficacy of DNA vaccines encoding influenza A proteins in aged mice,” Vaccine 16:1748-1755, Elsevier Science Ltd. (1998).
Bryder, K., et al., “Improved Immunogenicity of HIV-1 Epitopes in HbsAg Chimeric DNA Vaccine Plasmids by Structural Mutations of HbsAg,” DNA Cell Biol. 18:219-225, Mary Ann Liebert, Inc. (1999).
Deml, L., et al., “Multiple Effects of Codon Usage Optimization on Expression and Immunogenicity of DNA Candidate Vaccines Encoding the Human Immunodeficiency Virus Type 1 Gag Protein,” J. Virol. 75:10991-11001, American Society for Microbiology (2001).
Gaschen, B., et al., “Diversity Considerations in HIV-1 Vaccine Selection,” Science 296:2354-2360, American Association for the Advancement of Science (2002).
Liu, W.J., et al., “Polynucleotide viral vaccines: codon optimisation and ubiquitin conjugation enhances prophylactic and therapeutic efficacy,” Vaccine 20:862-869, Elsevier Science Ltd. (2002).
International Search Report for International Application No. PCT/US05/17157, mailed on Oct. 25, 2007, ISA/US, Alexandria, VA.
U.S. Appl. No. 11/718,973, inventors Luke et al., filed Mar. 9, 2007.
U.S. Appl. No. 11/892,016, inventors Luke et al., filed Aug. 17, 2007.
Lindstrom, S.E., et al., “Phylogenetic Analysis of the Entire Genome of Influenza A (H3N2) Viruses from Japan: Evidence for Genetic Reassortment of the Six Internal Genes,” J. Virol. 72:8021-8031, American Society for Microbiology (1998).
NCBI Database, GenBank Report, Accession No. AAC63479, “M1 protein [Influenza A virus H3N2],” 2 pages (first available 1998).
NCBI Database, GenBank Report, Accession No. AAC63480, “M2 protein [Influenza A virus H3N2],” 2 pages (first available 1998).
NCBI Database, GenBank Report, Accession No. AF038271, “Influenza A virus H3N2 A/Niigata/137/96 matrix protein M1 and transmembrane ion channel M2 protein (M) gene, complete cds,” 2 pages (first available 1998).
NCBI Database, GenBank Report, Accession No. Q38SQ6, “Matrix protein1 (M1),” 3 pages (first available Jan. 2007).
NCBI Database, GenBank Report, Accession No. Q76V11, “Matrix protein 2 (Protein channel protein M2),” 3 pages (first available 1991).
Prior Publications
Related Documents
Division of application No. US 11/131479 00, filed on 18-May-2005. [+1] [-1]
Provisional application No. US 60/571854 00, filed on 18-May-2004.
Examiners
Primary: Mosher, Mary E
Attorney, Agent or Firm
DLA Piper LLP (US)

Supplemental Information (Source: DOCDB)
Inventors
LUKE CATHERINE J [+5] [-5]
US
VILALTA ADRIAN
US
WLOCH MARY K
US
EVANS THOMAS G
US
GEALL ANDREW J
US
JIMENEZ GRETCHEN S
US
Assignees/Applicants
VICAL INC
US
Priority
US 704251 A  09-Feb-2007 [+2] [-2]
US 131479 A  18-May-2005
US 571854 P  18-May-2004
Classifications
International (2009.01): A61K 39/145; C07K 14/005
International (2006.01): A61K 39/145; C07K 14/11
European: A61K 39/145; C07K 16/10D
Preview up to the first 8 page images of this publication.
--- Page 1 ---
Page 1
--- Page 2 ---
Page 2
--- Page 3 ---
Page 3
--- Page 4 ---
Page 4
--- Page 5 ---
Page 5
--- Page 6 ---
Page 6
--- Page 7 ---
Page 7
--- Page 8 ---
Page 8
(Source: USPTO)
CROSS-REFERENCE TO RELATED APPLICATIONS
The present application is a divisional application of U.S. application Ser. No. 11/131,479, filed May 18, 2005, which claims the benefit of U.S. Provisional Application No. 60/571,854, filed May 18, 2004, both of which are incorporated herein by reference in their entireties.
REFERENCE TO A SEQUENCE LISTING SUBMITTED ELECTRONICALLY VIA EFS-WEB
This application includes a “SequenceListing.txt”, 334,953 bytes, created on Jun. 25, 2008 and submitted electronically via EFS-Web which is hereby incorporated by reference in its entirety.
BACKGROUND OF THE INVENTION
The present invention relates to influenza virus vaccine compositions and methods of treating or preventing influenza infection and disease in mammals. Influenza is an acute febrile illness caused by infection of the respiratory tract. There are three types of influenza viruses: A, B, and C “IAV,” “IBV” or “IAC,” respectively, or generally “IV”. Type A, which includes several subtypes, causes widespread epidemics and global pandemics such as those that occurred in 1918, 1957 and 1968. Type B causes regional epidemics. Type C causes sporadic cases and minor, local outbreaks. These virus types are distinguished in part on the basis of differences in two structural proteins, the nucleoprotein, found in the center of the virus, and the matrix protein, which forms the viral shell.
The disease can cause significant systemic symptoms, severe illness requiring hospitalization (such as viral pneumonia), and complications such as secondary bacterial pneumonia. More than 20 million people died during the pandemic flu season of 1918/1919, the largest pandemic of the 20th century. Recent epidemics in the United States are believed to have resulted in greater than 10,000 (up to 40,000) excess deaths per year and 5,000-10,000 deaths per year in non-epidemic years.
The best strategy for prevention of morbidity and mortality associated with influenza is vaccination. Vaccination is especially recommended for people in high-risk groups, such as residents of nursing or residential homes, as well as for diabetes, chronic renal failure, or chronic respiratory conditions.
Traditional methods of producing influenza vaccines involve growth of an isolated strain in embryonated hens' eggs. Initially, the virus is recovered from a throat swab or similar source and isolated in eggs. The initial isolation in egg is difficult, but the virus adapts to its egg host and subsequent propagation in eggs takes place relatively easily. It is widely recognized, however, that the egg-derived production of IV for vaccine purposes has several disadvantages. One disadvantage is that such production process is rather vulnerable due to the varying (micro)biological quality of the eggs. Another disadvantage is that the process completely lacks flexibility if demand suddenly increases, i.e., in case of a serious epidemic or pandemic, because of the logistical problems due to the non-availability of large quantities of suitable eggs. Also, vaccines thus produced are contra-indicated for persons with a known hypersensitivity to chicken and/or egg proteins.
The influenza vaccines currently in use are designated whole virus (WV) vaccine or subvirion (SV) (also called “split” or “purified surface antigen”). The WV vaccine contains intact, inactivated virus, whereas the SV vaccine contains purified virus disrupted with detergents that solubilize the lipid-containing viral envelope, followed by chemical inactivation of residual virus. Attenuated viral vaccines against influenza are also in development. A discussion of methods of preparing conventional vaccine may be found in Wright, P. F. & Webster, R. G., FIELDS VIROLOGY, 4d Ed. (Knipe, D. M. et al. Ed.), 1464-65 (2001), for example.
Virus Structures
An IV is roughly spherical, but it can also be elongated or irregularly shaped. Inside the virus, eight segments of single-stranded RNA contain the genetic instructions for making the virus. The most striking feature of the virus is a layer of spikes projecting outward over its surface. There are two different types of spikes: one is composed of the molecule hemagglutinin (HA), the other of neuraminidase (NA). The HA molecule allows the virus to “stick” to a cell, initiating infection. The NA molecule allows newly formed viruses to exit their host cell without sticking to the cell surface or to each other. The viral capsid is comprised of viral ribonucleic acid and several so called “internal” proteins (polymerases (PB1, PB2, and PA), matrix protein (M1) and nucleoprotein (NP)). Because antibodies against HA and NA have traditionally proved the most effective in fighting infection, much research has focused on the structure, function, and genetic variation of those molecules. Researchers are also interested in a two non-structural proteins M2 and NS1; both molecules play important roles in viral infection.
Type A subtypes are described by a nomenclature system that includes the geographic site of discovery; a lab identification number, the year of discovery, and in parentheses the type of HA and NA it possesses, for example, A/Hong Kong/156/97 (H5N1). If the virus infects non-humans, the host species is included before the geographical site, as in A/Chicken/Hong Kong/G9/97 (H9N2).
Virions contain 7 segments (influenza C virus) to 8 segments (influenza A and B virus) of linear negative-sense single stranded RNA. Most of the segments of the virus genome code for a single protein. For many influenza viruses, the whole genome is now known. Genetic reassortment of the virus results from intermixing of the parental gene segments in the progeny of the viruses when a cell is co-infected by two different viruses of a given type. This phenomenon is facilitated by the segmental nature of the genome of influenza virus. Genetic reassortment is manifested as sudden changes in the viral surface antigens.
Antigenic changes in HA and NA allow the influenza virus to have tremendous variability. Antigenic drift is the term used to indicate minor antigenic variations in HA and NA of the influenza virus from the original parent virus, while major changes in HA and NA which make the new virions significantly different, are called Antigenic shift. The difference between the two phenomena is a matter of degree.
Antigenic drift (minor changes) occurs due to accumulation of point mutations in the gene which results in changes in the amino acids in the proteins. Changes which are extreme, and drastic (too drastic to be explained by mutation alone) result in antigenic shift of the virus. The segmented genomes of the influenza viruses reassort readily in double infected cells. Genetic reassortment between human and non-human influenza virus has been suggested as a mechanism for antigenic shift. Influenza is a zoonotic disease, and an important pathogen in a number of animal species, including swine, horses, and birds, both wild and domestic. Influenza viruses are transferred to humans from other species.
Because of antigenic shift and antigenic drift, immunity to an IV carrying a particular HA and/or NA protein does not necessarily confer protective immunity against IV strains carrying variant, or different HA and/or NA proteins. Because antibodies against HA and NA have traditionally proved the most effective in fighting IV infection, much research has focused on the structure, function and genetic variation of those molecules.
Recent IV Vaccine Candidates
During the past few years, there has been substantial interest in testing DNA-based vaccines for a number of infectious diseases where the need for a vaccine, or an improved vaccine, exists. Several well-recognized advantages of DNA-based vaccines include the speed, ease and cost of manufacture, the versatility of developing and testing multivalent vaccines, the finding that DNA vaccines can produce a robust cellular response in a wide variety of animal models as well as in humans, and the proven safety of using plasmid DNA as a delivery vector (Donnelly, J. J., et al., Annu. Rev. Immunol. 15:617-648 (1997); Manickan, E., et al., Crit. Rev. Immunol. 17(2):139-154 (1997); U.S. Pat. No. 6,214,804). DNA vaccines represent the next generation in the development of vaccines (Nossal, G., Nat. Med. 4(5 Supple):475-476 (1998)) and numerous DNA vaccines are in clinical trials. The above references are herein incorporated by reference in their entireties.
Studies have already been performed using DNA-based vaccines in animals. Ulmer, J. B. et al., Science 259:1745-9 (1993) revealed that mice could be protected by an IV nucleoprotein DNA vaccine alone against severe disease and death resulting from either a homologous or a heterologous IV challenge. Further studies have substantiated this model, and comparative studies of live influenza vaccines versus DNA influenza vaccines show them to be relatively equivalent in immune induction and protection in the murine model.
WO 94/21797, incorporated herein by reference in its entirety, discloses IV vaccine compositions comprising DNA constructs encoding NP, HA, M1, PB1 and NS1. WO 94/21797 also discloses methods of protecting against IV infection comprising immunization with a prophylactically effective amount of these DNA vaccine compositions.
The IV nucleoprotein is relatively conserved (see Shu, L. L. et al., J. Virol. 67:2723-9 (1993)), but just as conserved are the M1 matrix protein (which is a major T-cell target), and the M2 protein, which are encoded by separate reading frames of RNA segment 7. See Neirynek, S. et al., Nat. Med. 5:1157-63 (1999); Lamb, R. A. & Lai, C. J., Virology 112:746-51 (1981); Ito, T. et al., J. Virol. 65:5491-8 (1991). Animal DNA vaccine trials have been performed with DNA constructs encoding these genes alone or in combination, usually with success. See Okuda, K., et al., Vaccine 19:3681-91 (2001); Watabe, S. et al., Vaccine 19:4434-44 (2001). Of interest, the M2 protein is involved as part of an ion channel, is critical in resistance to the antiviral agents amantadine and rimantadine, and approximately 24 amino acids are extracellular (eM2). See Fischer, W. B., Biochim Biophys Acta 1561:27-45 (2002); Zhong, Q., FEBS Lett 434:265-71 (1998). Antibodies to this extracellular, highly conserved protein (eM2), which is highly expressed in infected cells (Lamb, R. A., et al., Cell 40:627-33 (1985)), have been shown to be involved in animal models. Treanor, J. J., J. Virol. 64:1375-7 (1990); Slepushkin, V. A. et al., Vaccine 13:1399-402 (1995). An approach using a conjugate hepatitis B core-eM2 protein has been evaluated in an animal model and proposed as a pandemic influenza vaccine. Neirynck, S. et al., Nat. Med. 5:1157-63 (1999). However, in one study vaccination of pigs with a DNA construct expressing eM2-NP fusion protein exacerbated disease after challenge with influenza A virus. Heinen, P. P., J. Gen. Virol. 83:1851-59 (2002). All of the above references are herein incorporated by reference in their entireties
Heterologous “prime boost” strategies have been effective for enhancing immune responses and protection against numerous pathogens. Schneider et al., Immunol. Rev. 170:29-38 (1999); Robinson, H. L., Nat. Rev. Immunol. 2:239-50 (2002); Gonzalo, R. M. et al., Vaccine 20:1226-31 (2002); Tanghe, A., Infect. Immun. 69:3041-7 (2001). Providing antigen in different forms in the prime and the boost injections appears to maximize the immune response to the antigen. DNA vaccine priming followed by boosting with protein in adjuvant or by viral vector delivery of DNA encoding antigen appears to be the most effective way of improving antigen specific antibody and CD4+ T-cell responses or CD8+ T-cell responses respectively. Shiver J. W. et al., Nature 415: 331-5 (2002); Gilbert, S. C. et al., Vaccine 20:1039-45 (2002); Billaut-Mulot, O. et al., Vaccine 19:95-102 (2000); Sin, J. I. et al., DNA Cell Biol. 18:771-9 (1999). Recent data from monkey vaccination studies suggests that adding CRL1005 poloxamer (12 kDa, 5% POE), to DNA encoding the HIV gag antigen enhances T-cell responses when monkeys are vaccinated with an HIV gag DNA prime followed by a boost with an adenoviral vector expressing HIV gag (Ad5-gag). The cellular immune responses for a DNA/poloxamer prime followed by an Ad5-gag boost were greater than the responses induced with a DNA (without poloxamer) prime followed by Ad5-gag boost or for Ad5-gag only. Shiver, J. W. et al. Nature 415:331-5 (2002). U.S. Patent Appl. Publication No. US 2002/0165172 A1 describes simultaneous administration of a vector construct encoding an immunogenic portion of an antigen and a protein comprising the immunogenic portion of an antigen such that an immune response is generated. The document is limited to hepatitis B antigens and HIV antigens. Moreover, U.S. Pat. No. 6,500,432 is directed to methods of enhancing an immune response of nucleic acid vaccination by simultaneous administration of a polynucleotide and polypeptide of interest. According to the patent, simultaneous administration means administration of the polynucleotide and the polypeptide during the same immune response, preferably within 0-10 or 3-7 days of each other. The antigens contemplated by the patent include, among others, those of Hepatitis (all forms), HSV, HIV, CMV, EBV, RSV, VZV, HPV, polio, influenza, parasites (e.g., from the genus Plasmodium), and pathogenic bacteria (including but not limited to M. tuberculosis, M. leprae, Chlamydia, Shigella, B. burgdorferi, enterotoxigenic E. coli, S. typhosa, H. pylori, V. cholerae, B. pertussis, etc.). All of the above references are herein incorporated by reference in their entireties.
SUMMARY OF THE INVENTION
The present invention is directed to enhancing the immune response of a vertebrate in need of protection against IV infection by administering in vivo, into a tissue of the vertebrate, at least one polynucleotide, wherein the polynucleotide comprises one or more nucleic acid fragments, where the one or more nucleic acid fragments are optionally fragments of codon-optimized coding regions operably encoding one or more IV polypeptides, or fragments, variants, or derivatives thereof. The present invention is further directed to enhancing the immune response of a vertebrate in need of protection against IV infection by administering, in vivo, into a tissue of the vertebrate, a polynucleotide described above plus at least one isolated IV polypeptide or a fragment, a variant, or derivative thereof. The isolated IV polypeptide can be, for example, a purified subunit, a recombinant protein, a viral vector expressing an isolated IV polypeptide, or can be an inactivated or attentuated IV, such as those present in conventional IV vaccines. According to either method, the polynucleotide is incorporated into the cells of the vertebrate in vivo, and an immunologically effective amount of an immunogenic epitope of the encoded IV polypeptide, or a fragment, variant, or derivative thereof, is produced in vivo. When utilized, an isolated IV polypeptide or a fragment, variant, or derivative thereof is also administered in an immunologically effective amount.
According to the present invention, the polynucleotide can be administered either prior to, at the same time (simultaneously), or subsequent to the administration of the isolated IV polypeptide. The IV polypeptide or fragment, variant, or derivative thereof encoded by the polynucleotide comprises at least one immunogenic epitope capable of eliciting an immune response to influenza virus in a vertebrate. In addition, an isolated IV polypeptide or fragment, variant, or derivative thereof, when used, comprises at least one immunogenic epitope capable of eliciting an immune response in a vertebrate. The IV polypeptide or fragment, variant, or derivative thereof encoded by the polynucleotide can, but need not, be the same protein or fragment, variant, or derivative thereof as the isolated IV polypeptide which can be administered according to the method.
The polynucleotide of the invention can comprise a nucleic acid fragment, where the nucleic acid fragment is a fragment of a codon-optimized coding region operably encoding any IV polypeptide or fragment, variant, or derivative thereof, including, but not limited to, HA, NA, NP, M1 or M2 proteins or fragments (e.g., eM2), variants or derivatives thereof. A polynucleotide of the invention can also encode a derivative fusion protein, wherein two or more nucleic acid fragments, at least one of which encodes an IV polypeptide or fragment, variant, or derivative thereof, are joined in frame to encode a single polypeptide, e.g., NP fused to eM2. Additionally, a polynucleotide of the invention can further comprise a heterologous nucleic acid or nucleic acid fragment. Such heterologous nucleic acid or nucleic acid fragment may encode a heterologous polypeptide fused in frame with the polynucleotide encoding the IV polypeptide, e.g., a hepatitis B core protein or a secretory signal peptide. Preferably, the polynucleotide encodes an IV polypeptide or fragment, variant, or derivative thereof comprising at least one immunogenic epitope of IV, wherein the epitope elicits a B-cell (antibody) response, a T-cell (e.g., CTL) response, or both.
Similarly, the isolated IV polypeptide or fragment, variant, or derivative thereof to be delivered (either a recombinant protein, a purified subunit, or viral vector expressing an isolated IV polypeptide, or in the form of an inactivated IV vaccine) can be any isolated IV polypeptide or fragment, variant, or derivative thereof, including but not limited to the HA, NA, NP, M1 or M2 proteins or fragments (e.g., eM2), variants or derivatives thereof. In certain embodiments, a derivative protein can be a fusion protein, e.g., NP-eM2. In other embodiments, the isolated IV polypeptide or fragment, variant, or derivative thereof can be fused to a heterologous protein, e.g., a secretory signal peptide or the hepatitis B virus core protein. Preferably, the isolated IV polypeptide or fragment, variant, or derivative thereof comprises at least one immunogenic epitope of IV, wherein the antigen elicits a B-cell antibody response, a T-cell antibody response, or both.
Nucleic acids and fragments thereof of the present invention can be altered from their native state in one or more of the following ways. First, a nucleic acid or fragment thereof which encodes an IV polypeptide or fragment, variant, or derivative thereof can be part or all of a codon-optimized coding region, optimized according to codon usage in the animal in which the vaccine is to be delivered. In addition, a nucleic acid or fragment thereof which encodes an IV polypeptide can be a fragment which encodes only a portion of a full-length polypeptide, and/or can be mutated so as to, for example, remove from the encoded polypeptide non-desired protein motifs present in the encoded polypeptide or virulence factors associated with the encoded polypeptide. For example, the nucleic acid sequence could be mutated so as not to encode a membrane anchoring region that would prevent release of the polypeptide from the cell as with, e.g., eM2. Upon delivery, the polynucleotide of the invention is incorporated into the cells of the vertebrate in vivo, and a prophylactically or therapeutically effective amount of an immunologic epitope of an IV is produced in vivo.
Similarly, the proteins of the invention can be a fragment of a full-length IV polypeptide and/or can be altered so as to, for example, remove from the polypeptide non-desired protein motifs present in the polypeptide or virulence factors associated with the polypeptide. For example, the polypeptide could be altered so as not to encode a membrane anchoring region that would prevent release of the polypeptide from the cell.
The invention further provides immunogenic compositions comprising at least one polynucleotide, wherein the polynucleotide comprises one or more nucleic acid fragments, where each nucleic acid fragment is a fragment of a codon-optimized coding region encoding an IV polypeptide or a fragment, a variant, or a derivative thereof; and immunogenic compositions comprising a polynucleotide as described above and at least one isolated IV polypeptide or a fragment, a variant, or derivative thereof. Such compositions can further comprise, for example, carriers, excipients, transfection facilitating agents, and/or adjuvants as described herein.
The immunogenic compositions comprising a polynucleotide and an isolated IV polypeptide or fragment, variant, or derivative thereof as described above can be provided so that the polynucleotide and protein formulation are administered separately, for example, when the polynucleotide portion of the composition is administered prior (or subsequent) to the isolated IV polypeptide portion of the composition. Alternatively, immunogenic compositions comprising the polynucleotide and the isolated IV polypeptide or fragment, variant, or derivative thereof can be provided as a single formulation, comprising both the polynucleotide and the protein, for example, when the polynucleotide and the protein are administered simultaneously. In another alternative, the polynucleotide portion of the composition and the isolated IV polypeptide portion of the composition can be provided simultaneously, but in separate formulations.
Compositions comprising at least one polynucleotide comprising one or more nucleic acid fragments, where each nucleic acid fragment is optionally a fragment of a codon-optimized coding region operably encoding an IV polypeptide or fragment, variant, or derivative thereof together with and one or more isolated IV polypeptides or fragments, variants or derivatives thereof (as either a recombinant protein, a purified subunit, a viral vector expressing the protein, or in the form of an inactivated or attenuated IV vaccine) will be referred to herein as “combinatorial polynucleotide (e.g., DNA) vaccine compositions” or “single formulation heterologous prime-boost vaccine compositions.”
The compositions of the invention can be univalent, bivalent, trivalent or mulitvalent. A univalent composition will comprise only one polynucleotide comprising a nucleic acid fragment, where the nucleic acid fragment is optionally a fragment of a codon-optimized coding region encoding an IV polypeptide or a fragment, variant, or derivative thereof, and optionally the same IV polypeptide or a fragment, variant, or derivative thereof in isolated form. In a single formulation heterologous prime-boost vaccine composition, a univalent composition can include a polynucleotide comprising a nucleic acid fragment, where the nucleic acid fragment is optionally a fragment of a codon-optimized coding region encoding an IV polypeptide or a fragment, variant, or derivative thereof and an isolated polypeptide having the same antigenic region as the polynucleotide. A bivalent composition will comprise, either in polynucleotide or protein form, two different IV polypeptides or fragments, variants, or derivatives thereof, each capable of eliciting an immune response. The polynucleotide(s) of the composition can encode two IV polypeptides or alternatively, the polynucleotide can encode only one IV polypeptide and the second IV polypeptide would be provided by an isolated IV polypeptide of the invention as in, for example, a single formulation heterologous prime-boost vaccine composition. In the case where both IV polypeptides of a bivalent composition are delivered in polynucleotide form, the nucleic acid fragments operably encoding those IV polypeptides need not be on the same polynucleotide, but can be on two different polynucleotides. A trivalent or further multivalent composition will comprise three IV polypeptides or fragments, variants or derivatives thereof, either in isolated form or encoded by one or more polynucleotides of the invention.
The present invention further provides plasmids and other polynucleotide constructs for delivery of nucleic acid fragments of the invention to a vertebrate, e.g., a human, which provide expression of IV polypeptides, or fragments, variants, or derivatives thereof. The present invention further provides carriers, excipients, transfection-facilitating agents, immunogenicity-enhancing agents, e.g., adjuvants, or other agent or agents to enhance the transfection, expression or efficacy of the administered gene and its gene product.
In one embodiment, a mulitvalent composition comprises a single polynucleotide, e.g., plasmid, comprising one or more nucleic acid regions operably encoding IV polypeptides or fragments, variants, or derivatives thereof. Reducing the number of polynucleotides, e.g., plasmids in the compositions of the invention can have significant impacts on the manufacture and release of product, thereby reducing the costs associated with manufacturing the compositions. There are a number of approaches to include more than one expressed antigen coding sequence on a single plasmid. These include, for example, the use of Internal Ribosome Entry Site (IRES) sequences, dual promoters/expression cassettes, and fusion proteins.
The invention also provides methods for enhancing the immune response of a vertebrate to IV infection by administering to the tissues of a vertebrate one or more polynucleotides each comprising one or more nucleic acid fragments, where each nucleic acid fragment is optionally a fragment of a codon-optimized coding region encoding an IV polypeptide or fragment, variant, or derivative thereof; and optionally administering to the tissues of the vertebrate one or more isolated IV polypeptides, or fragments, variants, or derivatives thereof. The isolated IV polypeptide can be administered prior to, at the same time (simultaneously), or subsequent to administration of the polynucleotides encoding IV polypeptides.
In addition, the invention provides consensus amino acid sequences for IV polypeptides, or fragments, variants or derivatives thereof, including, but not limited to the HA, NA, NP, M1 or M2 proteins or fragments (e.g. eM2), variants or derivatives thereof. Polynucleotides which encode the consensus polypeptides or fragments, variants or derivatives thereof, are also embodied in this invention. Such polynucleotides can be obtained by known methods, for example by backtranslation of the amino acid sequence and PCR synthesis of the corresponding polynucleotide as described below.
BRIEF DESCRIPTION OF THE FIGURES
FIGS. 1A-1D show an alignment of nucleotides 46-1542 of SEQ ID NO:1 (native NP coding region) with a coding region fully codon-optimized for human usage (SEQ ID NO:23).
FIG. 2 shows the protocol for the preparation of a formulation comprising 0.3 mM BAK, 7.5 mg/ml CRL 1005 and 5 mg/mil of DNA in a final volume of 3.6 ml, through the use of thermal cycling.
FIG. 3 shows the protocol for the preparation of a formulation comprising 0.3 mM BAK, 34 mg/ml or 50 mg/ml CRL 1005 and 2.5 mg/ml DNA in a final volume of 4.0 ml, through the use of thermal cycling.
FIG. 4 shows the protocol for the simplified preparation (without thermal cycling) of a formulation comprising 0.3 mM BAK, 7.5 mg/ml CRL 1005 and 5 mg/ml DNA.
FIG. 5 shows the anti-NP antibody response three weeks after a single administration of a combinatorial prime-boost vaccine formulation against the influenza virus NP protein.
FIG. 6 shows the anti-NP antibody response twelve days after a second administration of a combinatorial prime-boost vaccine formulation against the influenza virus NP protein.
FIG. 7 shows the CD8+ T Cell response to a combinatorial prime-boost vaccine formulation against the influenza virus NP protein.
FIG. 8 shows the CD4+ T Cell response to a combinatorial prime-boost vaccine formulation against the influenza virus NP protein.
FIGS. 9A and 9B show the results of a two dose mouse immunization regimen study with plasmid DNA encoding IAV HA (H3).
FIGS. 10A and 10B show the in vitro expression of M1 and M2 from segment 7 and an M1M2 fusion.
FIGS. 11A and 11B show the in vitro expression of eM2-NP and codon-optimized influenza virus NP protein.
FIGS. 12A-12D show the influenza A NP protein consensus amino acid sequence (SEQ ID NO: 76) aligned with 22 full length NP sequences. A dotted line indicates the same amino acid and a dashed line indicates that no sequence was available. Twenty-two NP full-length, or nearly full-length sequences were available for comparison on the World Wide Web at URL flu.lan1.gov. The amino acid chosen for the consensus sequences was based on the majority of the 22 sequences examined. In instances of a tie, the amino acid found in strain 2000 was favored.
FIG. 13 is a schematic diagram of various vectors encoding influenza proteins described herein.
FIG. 14 are the results of western blot experiments as described in Example 13, Experiment 3. The blots show lysates of VM92 cells transfected with plasmids which express M2 or NP to compare expression of the influenza protein from different expression vectors.
FIG. 15 are the results of western blot experiments as described in Example 13, Experiment 3. The blots show lysates of VM92 cells transfected with plasmids which express M1, M2 or NP to compare expression of the influenza protein from expression vectors.
DETAILED DESCRIPTION OF THE INVENTION
The present invention is directed to compositions and methods for enhancing the immune response of a vertebrate in need of protection against IV infection by administering in vivo, into a tissue of a vertebrate, at least one polynucleotide comprising one or more nucleic acid fragments, where each nucleic acid fragment is optionally a fragment of a codon-optimized coding region operably encoding an IV polypeptide, or a fragment, variant, or derivative thereof in cells of the vertebrate in need of protection. The present invention is also directed to administering in vivo, into a tissue of the vertebrate the above described polynucleotide and at least one isolated IV polypeptide, or a fragment, variant, or derivative thereof. The isolated IV polypeptide or fragment, variant, or derivative thereof can be, for example, a recombinant protein, a purified subunit protein, a protein expressed and carried by a heterologous live or inactivated or attentuated viral vector expressing the protein, or can be an inactivated IV, such as those present in conventional, commercially available, inactivated IV vaccines. According to either method, the polynucleotide is incorporated into the cells of the vertebrate in vivo, and an immunologically effective amount of the influenza protein, or fragment or variant encoded by the polynucleotide is produced in vivo. The isolated protein or fragment, variant, or derivative thereof is also administered in an immunologically effective amount. The polynucleotide can be administered to the vertebrate in need thereof either prior to, at the same time (simultaneously), or subsequent to the administration of the isolated IV polypeptide or fragment, variant, or derivative thereof.
Non-limiting examples of IV polypeptides within the scope of the invention include, but are not limited to, NP, HA, NA, M1 and M2 polypeptides, and fragments, e.g., eM2, derivatives, e.g., an NP-eM2 fusion, and variants thereof. Nucleotide and amino acid sequences of IV polypeptides from a wide variety of IV types and subtypes are known in the art. The nucleotide sequences set out below are the wild-type sequences. For example, the nucleotide sequence of the NP protein of Influenza A/PR/8/34 (H1N1) is available as GenBank Accession Number M38279.1, and has the following sequence, referred to herein as SEQ ID NO:1:
AGCAAAAGCAGGGTAGATAATCACTCACTGAGTGACATCAAAATCATGGC
GTCTCAAGGCACCAAACGATCTTACGAACAGATGGAGACTGATGGAGAAC
GCCAGAATGCCACTGAAATCAGAGCATCCGTCGGAAAAATGATTGGTGGA
ATTGGACGATTCTACATCCAAATGTGCACCGAACTCAAACTCAGTGATTA
TGAGGGACGGTTGATCCAAAACAGCTTAACAATAGAGAGAATGGTGCTCT
CTGCTTTTGACGAAAGGAGAAATAAATACCTTGAAGAACATCCCAGTGCG
GGGAAAGATCCTAAGAAAACTGGAGGACCTATATACAGGAGAGTAAACGG
AAAGTGGATGAGAGAACTCATCCTTTATGACAAAGAAGAAATAAGGCGAA
TCTGGCGCCAAGCTAATAATGGTGACGATGCAACGGCTGGTCTGACTCAC
ATGATGATCTGGCATTCCAATTTGAATGATGCAACTTATCAGAGGACAAG
AGCTCTTGTTCGCACCGGAATGGATCCCAGGATGTGCTCTCTGATGCAAG
GTTCAACTCTCCCTAGGAGGTCTGGAGCCGCAGGTGCTGCAGTCAAAGGA
GTTGGAACAATGGTGATGGAATTGGTCAGAATGATCAAACGTGGGATCAA
TGATCGGAACTTCTGGAGGGGTGAGAATGGACGAAAAACAAGAATTGCTT
ATGAAAGAATGTGCAACATTCTCAAAGGGAAATTTCAAACTGCTGCACAA
AAAGCAATGATGGATCAAGTGAGAGAGAGCCGGAACCCAGGGAATGCTGA
GTTCGAAGATCTCACTTTTCTAGCACGGTCTGCACTCATATTGAGAGGGT
CGGTTGCTCACAAGTCCTGCCTGCCTGCCTGTGTGTATGGACCTGCCGTA
GCCAGTGGGTACGACTTTGAAAGGGAGGGATACTCTCTAGTCGGAATAGA
CCCTTTCAGACTGCTTCAAAACAGCCAAGTGTACAGCCTAATCAGACCAA
ATGAGAATCCAGCACACAAGAGTCAACTGGTGTGGATGGCATGCCATTCT
GCCGCATTTGAAGATCTAAGAGTATTAAGCTTCATCAAAGGGACGAAGGT
GCTCCCAAGAGGGAAGCTTTCCACTAGAGGAGTTCAAATTGCTTCCAATG
AAAATATGGAGACTATGGAATCAAGTACACTTGAACTGAGAAGCAGGTAC
TGGGCCATAAGGACCAGAAGTGGAGGAAACACCAATCAACAGAGGGCATC
TGCGGGCCAAATCAGCATACAACCTACGTTCTCAGTACAGAGAAATCTCC
CTTTTGACAGAACAACCGTTATGGCAGCATTCAGTGGGAATACAGAGGGG
AGAACATCTGACATGAGGACCGAAATCATAAGGATGATGGAAAGTGCAAG
ACCAGAAGATGTGTCTTTCCAGGGGCGGGGAGTCTTCGAGCTCTCGGACG
AAAAGGCAGCGAGCCCGATCGTGCCTTCCTTTGACATGAGTAATGAAGGA
TCTTATTTCTTCGGAGACAATGCAGAGGAATACGATAATTAAAGAAAAAT
ACCCTTGTTTCTACT
The amino acid sequence of the NP protein of Influenza A/PR/8/34 (H1N1), encoded by nucleotides 46-1494 of SEQ ID NO:1 is as follows, referred to herein as SEQ ID NO:2:
MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLS
DYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRV
NGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQR
TRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRG
INDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGN
AEFEDLTFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEREGYSLVG
IDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVLSFIKGT
KVLPRGKLSTRGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQR
ASAGQISIQPTFSVQRNLPFDRTTVMAAFSGNTEGRTSDMRTEIIRMMES
ARPEDVSFQGRGVFELSDEKAASPIVPSFDMSNEGSYFFGDNAEEYDN
Segment 7 of the IAV genome encodes both M1 and M2. Segment 7 of Influenza A virus (A/Puerto Rico/8/34/Mount Sinai (H1N1)), is available as GenBank Accession No. AF389121.1, and has the following sequence, referred to herein as SEQ ID NO:3:
AGCGAAAGCAGGTAGATATTGAAAGATGAGTCTTCTAACCGAGGTCGAAA
CGTACGTACTCTCTATCATCCCGTCAGGCCCCCTCAAAGCCGAGATCGCA
CAGAGACTTGAAGATGTCTTTGCAGGGAAGAACACTGATCTTGAGGTTCT
CATGGAATGGCTAAAGACAAGACCAATCCTGTCACCTCTGACTAAGGGGA
TTTTAGGATTTGTGTTCACGCTCACCGTGCCCAGTGAGCGAGGACTGCAG
CGTAGACGCTTTGTCCAAAATGCCCTTAATGGGAACGGGGATCCAAATAA
CATGGACAAAGCAGTTAAACTGTATAGGAAGCTCAAGAGGGAGATAACAT
TCCATGGGGCCAAAGAAATCTCACTCAGTTATTCTGCTGGTGCACTTGCC
AGTTGTATGGGCCTCATATACAACAGGATGGGGGCTGTGACCACTGAAGT
GGCATTTGGCCTGGTATGTGCAACCTGTGAACAGATTGCTGACTCCCAGC
ATCGGTCTCATAGGCAAATGGTGACAACAACCAATCCACTAATCAGACAT
GAGAACAGAATGGTTTTAGCCAGCACTACAGCTAAGGCTATGGAGCAAAT
GGCTGGATCGAGTGAGCAAGCAGCAGAGGCCATGGAGGTTGCTAGTCAGG
CTAGACAAATGGTGCAAGCGATGAGAACCATTGGGACTCATCCTAGCTCC
AGTGCTGGTCTGAAAAATGATCTTCTTGAAAATTTGCAGGCCTATCAGAA
ACGAATGGGGGTGCAGATGCAACGGTTCAAGTGATCCTCTCGCTATTGCC
GCAAATATCATTGGGATCTTGCACTTGACATTGTGGATTCTTGATCGTCT
TTTTTTCAAATGCATTTACCGTCGCTTTAAATACGGACTGAAAGGAGGGC
CTTCTACGGAAGGAGTGCCAAAGTCTATGAGGGAAGAATATCGAAAGGAA
CAGCAGAGTGCTGTGGATGCTGACGATGGTCATTTTGTCAGCATAGAGCT
GGAGTAAAAAACTACCTTGTTTCTACT
The amino acid sequence of the M1 protein of Influenza A/Puerto Rico/8/34/Mount Sinai(H1N1), encoded by nucleotides 26 to 784 of SEQ ID NO:3 is as follows, referred to herein as SEQ ID NO:4:
MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRP
ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLY
RKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEEVAFGLVCA
TCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQA
AEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQ
RFK
The amino acid sequence of the M2 protein of Influenza A/Puerto Rico/8/34/Mount Sinai (H1N1), encoded (in spliced form) by nucleotides 26 to 51 and 740 to 1007 of SEQ ID NO:3 is as follows, referred to herein as SEQ ID NO:5:
MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLTLWILDRLFFKC
IYRRFKYGLKGGPSTEGVPKSMREEYRKEQQSAVDADDGHFVSIELE
The Extracellular region of the M2 protein (eM2) corresponds to the first 24 amino acids of the N-terminal end of the protein, and is underlined above. See Fischer, W. B. et al., Biochim. Biophys. Acta. 1561:27-45 (2002); Zhong, Q. et al., FEBS Lett. 434:265-71 (1998).
A derivative of NP and eM2 described herein is encoded by a construct which encodes the first 24 amino acids of M2 and all or a portion of NP. The fusion constructs may be constructed with the eM2 sequences followed by the NP sequences, or with the NP sequences followed by the eM2 sequences. Exemplary fusion constructs using the NP and M2 sequences from Influenza A/PR/8134 (H1N1) are set out below. A sequence, using the original influenza virus nucleotide sequences, which encodes the first 24 amino acids of M2 fused at its 3′ end to a sequence which encodes NP in its entirety eM2-NP is referred to herein as SEQ ID NO:6:
   1 ATGAGTCTTC TAACCGAGGT CGAAACGCCT ATCAGAAACG AATGGGGGTG CAGATGCAAC
  61 GGTTCAAGTG ATATGGCGTC TCAAGGCACC AAACGATCTT ACGAACAGAT GGAGACTGAT
 121 GGAGAACGCC AGAATGCCAC TGAAATCAGA GCATCCGTCG GAAAAATGAT TGGTGGAATT
 181 GGACGATTCT ACATCCAAAT GTGCACCGAA CTCAAACTCA GTGATTATGA GGGACGGTTG
 241 ATCCAAAACA GCTTAACAAT AGAGAGAATG GTGCTCTCTG CTTTTGACGA AAGGAGAAAT
 301 AAATACCTTG AAGAACATCC CAGTGCGGGG AAAGATCCTA AGAAAACTGG AGGACCTATA
 361 TACAGGAGAG TAAACGGAAA GTGGATGAGA GAACTCATCC TTTATGACAA AGAAGAAATA
 421 AGGCGAATCT GGCGCCAAGC TAATAATGGT GACGATGCAA CGGCTGGTCT GACTCACATG
 481 ATGATCTGGC ATTCCAATTT GAATGATGCA ACTTATCAGA GGACAAGAGC TCTTGTTCGC
 541 ACCGGAATGG ATCCCAGGAT GTGCTCTCTG ATGCAAGGTT CAACTCTCCC TAGGAGGTCT
 601 GGAGCCGCAG GTGCTGCAGT CAAAGGAGTT GGAACAATGG TGATGGAATT GGTCAGAATG
 661 ATCAAACGTG GGATCAATGA TCGGAACTTC TGGAGGGGTG AGAATGGACG AAAAACAAGA
 721 ATTGCTTATG AAAGAATGTG CAACATTCTC AAAGGGAAAT TTCAAACTGC TGCACAAAAA
 781 GCAATGATGG ATCAAGTGAG AGAGAGCCGG AACCCAGGGA ATGCTGAGTT CGAAGATCTC
 841 ACTTTTCTAG CACGGTCTGC ACTCATATTG AGAGGGTCGG TTGCTCACAA GTCCTGCCTG
 901 CCTGCCTGTG TGTATGGACC TGCCGTAGCC AGTGGGTACG ACTTTGAAAG GGAGGGATAC
 961 TCTCTAGTCG GAATAGACCC TTTCAGACTG CTTCAAAACA GCCAAGTGTA CAGCCTAATC
1021 AGACCAAATG AGAATCCAGC ACACAAGAGT CAACTGGTGT GGATGGCATG CCATTCTGCC
1081 GCATTTGAAG ATCTAAGAGT ATTAAGCTTC ATCAAAGGGA CGAAGGTGCT CCCAAGAGGG
1141 AAGCTTTCCA CTAGAGGAGT TCAAATTGCT TCCAATGAAA ATATGGAGAC TATGGAATCA
1201 AGTACACTTG AACTGAGAAG CAGGTACTGG GCCATAAGGA CCAGAAGTGG AGGAAACACC
1261 AATCAACAGA GGGCATCTGC GGGCCAAATC AGCATACAAC CTACGTTCTC AGTACAGAGA
1321 AATCTCCCTT TTGACAGAAC AACCGTTATG GCAGCATTCA GTGGGAATAC AGAGGGGAGA
1381 ACATCTGACA TGAGGACCGA AATCATAAGG ATGATGGAAA GTGCAAGACC AGAAGATGTG
1441 TCTTTCCAGG GGCGGGGAGT CTTCGAGCTC TCGGACGAAA AGGCAGCGAG CCCGATCGTG
1501 CCTTCCTTTG ACATGAGTAA TGAAGGATCT TATTTCTTCG GAGACAATGC AGAGGAATAC
1561 GATAAT
The amino acid sequence of the eM2-NP fusion protein of Influenza A/PR/8/34/(H1N1), encoded by nucleotides 1 to 1566 SEQ ID NO:6 is as follows, referred to herein as SEQ ID NO:7 (eM2 amino acid sequence underlined):
MSLLTEVETPIRNEWGCRCNGSSDMASQGTKRSYEQMETDGERQNATEIR
ASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRN
KYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIWRQANNG
DDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRS
GAAGAAVKGVGTMVMELVRMIKRGINDRNFWRGENGRKTRIAYERMCNIL
KGKFQTAAQKAMMDQVRESRNPGNAEFEDLTFLARSALILRGSVAHKSCL
PACVYGPAVASGYDFEREGYSLVGIDPFRLLQNSQVYSLIRPNENPAHKS
QLVWMACHSAAFEDLRVLSFIKGTKVLPRGKLSTRGVQIASNENMETMES
STLELRSRYWAIRTRSGGNTNQQRASAGQISIQPTFSVQRNLPFDRTTVM
AAFSGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKAASPIV
PSFDMSNEGSYFFGDNAEEYDN
A sequence, using the original influenza virus nucleotide sequences, which encodes NP in its entirety fused at its 3′ end to the first 24 amino acids of M2 fused to a sequence which encodes NP in its entirety is referred to herein as SEQ ID NO:8:
ATGGCGTCTCAAGGCACCAAACGATCTTACGAACAGATGGAGACTGATGG
AGAACGCCAGAATGCCACTGAAATCAGAGCATCCGTCGGAAAAATGATTG
GTGGAATTGGACGATTCTACATCCAAATGTGCACCGAACTCAAACTCAGT
GATTATGAGGGACGGTTGATCCAAAACAGCTTAACAATAGAGAGAATGGT
GCTCTCTGCTTTTGACGAAAGGAGAAATAAATACCTTGAAGAACATCCCA
GTGCGGGGAAAGATCCTAAGAAAACTGGAGGACCTATATACAGGAGAGTA
AACGGAAAGTGGATGAGAGAACTCATCCTTTATGACAAAGAAGAAATAAG
GCGAATCTGGCGCCAAGCTAATAATGGTGACGATGCAACGGCTGGTCTGA
CTCACATGATGATCTGGCATTCCAATTTGAATGATGCAACTTATCAGAGG
ACAAGAGCTCTTGTTCGCACCGGAATGGATCCCAGGATGTGCTCTCTGAT
GCAAGGTTCAACTCTCCCTAGGAGGTCTGGAGCCGCAGGTGCTGCAGTCA
AAGGAGTTGGAACAATGGTGATGGAATTGGTCAGAATGATCAAACGTGGG
ATCAATGATCGGAACTTCTGGAGGGGTGAGAATGGACGAAAAACAAGAAT
TGCTTATGAAAGAATGTGCAACATTCTCAAAGGGAAATTTCAAACTGCTG
CACAAAAAGCAATGATGGATCAAGTGAGAGAGAGCCGGAACCCAGGGAAT
GCTGAGTTCGAAGATCTCACTTTTCTAGCACGGTCTGCACTCATATTGAG
AGGGTCGGTTGCTCACAAGTCCTGCCTGCCTGCCTGTGTGTATGGACCTG
CCGTAGCCAGTGGGTACGACTTTGAAAGGGAGGGATACTCTCTAGTCGGA
ATAGACCCTTTCAGACTGCTTCAAAACAGCCAAGTGTACAGCCTAATCAG
ACCAAATGAGAATCCAGCACACAAGAGTCAACTGGTGTGGATGGCATGCC
ATTCTGCCGCATTTGAAGATCTAAGAGTATTAAGCTTCATCAAAGGGACG
AAGGTGCTCCCAAGAGGGAAGCTTTCCACTAGAGGAGTTCAAATTGCTTC
CAATGAAAATATGGAGACTATGGAATCAAGTACACTTGAACTGAGAAGCA
GGTACTGGGCCATAAGGACCAGAAGTGGAGGAAACACCAATCAACAGAGG
GCATCTGCGGGCCAAATCAGCATACAACCTACGTTCTCAGTACAGAGAAA
TCTCCCTTTTGACAGAACAACCGTTATGGCAGCATTCAGTGGGAATACAG
AGGGGAGAACATCTGACATGAGGACCGAAATCATAAGGATGATGGAAAGT
GCAAGACCAGAAGATGTGTCTTTCCAGGGGCGGGGAGTCTTCGAGCTCTC
GGACGAAAAGGCAGCGAGCCCGATCGTGCCTTCCTTTGACATGAGTAATG
AAGGATCTTATTTCTTCGGAGACAATGCAGAGGAATACGATAATATGAGT
CTTCTAACCGAGGTCGAAACGCCTATCAGAAACGAATGGGGGTGCAGATG
CAACGGTTCAAGTGAT
The amino acid sequence of the NP-eM2 fusion protein of Influenza A/PR/8/34/(H1N1), encoded by nucleotides 1 to 1566 of SEQ ID NO:8 is as follows, referred to herein as SEQ ID NO:9 (eM2 amino acid sequence underlined):
MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSD
YEGRLIQMSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNG
KWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQRTR
ALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRGIN
DRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGNAE
FEDLTFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEREGYSLVGID
PFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVLSFIKGTKV
LPRGKLSTRGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQRAS
AGQISIQPTFSVQRNLPFDRTTVMAAFSGNTEGRTSDMRTEIIRMMESAR
PEDVSFQGRGVFELSDEKAASPIVPSFDMSNEGSYFFGDNAEEYDNMSLL
TEVETPIRNEWGCRCNGSSD
The construction of functional fusion proteins often requires a linker sequence between the two fused fragments, in order to adopt an extended conformation to allow maximal flexibility. We used program LINKER (Chiquita J. Crasto C. J. and Feng, J. Protein Engineering 13:309-312 (2000), program publicly available at chutney.med.yale.edu/linker/linker.html (visited Apr. 16, 2003)), that can automatically generate a set of linker sequences, which are known to adopt extended conformations as determined by X-ray crystallography and NMR. Examples of suitable linkers to use in various eM2-NP or NP-eM2 fusion proteins are as follows:
GYNTRA (SEQ ID NO:10)
FQMGET (SEQ ID NO:11)
FDRVKHLK (SEQ ID NO:12)
GRNTNGVIT (SEQ ID NO:13)
VNEKTIPDHD (SEQ ID NO:14)
The nucleotide sequence of the NP protein of Influenza B/LEE/40 is available as GenBank Accession Number K01395, and has the following sequence, referred to herein as SEQ ID NO:15:
   1 ATGTCCAACA TGGATATTGA CAGTATAAAT ACCGGAACAA TCGATAAAAC ACCAGAAGAA
  61 CTGACTCCCG GAACCAGTGG GGCAACCAGA CCAATCATCA AGCCAGCAAC CCTTGCTCCG
 121 CCAAGCAACA AACGAACCCG AAATCCATCT CCAGAAAGGA CAACCACAAG CAGTGAAACC
 181 GATATCGGAA GGAAAATCCA AAAGAAACAA ACCCCAACAG AGATAAAGAA GAGCGTCTAC
 241 AAAATGGTGG TAAAACTGGG TGAATTCTAC AACCAGATGA TGGTCAAAGC TGGACTTAAT
 301 GATGACATGG AAAGGAATCT AATTCAAAAT GCACAAGCTG TGGAGAGAAT CCTATTGGCT
 361 GCAACTGATG ACAAGAAAAC TGAATACCAA AAGAAAAGGA ATGCCAGAGA TGTCAAAGAA
 421 GGGAAGGAAG AAATAGACCA CAACAAGACA GGAGGCACCT TTTATAAGAT GGTAAGAGAT
 481 GATAAAACCA TCTACTTCAG CCCTATAAAA ATTACCTTTT TAAAAGAAGA GGTGAAAACA
 541 ATGTACAAGA CCACCATGGG GAGTGATGGT TTCAGTGGAC TAAATCACAT TATGATTGGA
 601 CATTCACAGA TGAACGATGT CTGTTTCCAA AGATCAAAGG GACTGAAAAG GGTTGGACTT
 661 GACCCTTCAT TAATCAGTAC TTTTGCCGGA AGCACACTAC CCAGAAGATC AGGTACAACT
 721 GGTGTTGCAA TCAAAGGAGG TGGAACTTTA GTGGATGAAG CCATCCGATT TATAGGAAGA
 781 GCAATGGCAG ACAGAGGGCT ACTGAGAGAC ATCAAGGCCA AGACGGCCTA TGAAAAGATT
 841 CTTCTGAATC TGAAAAACAA GTGCTCTGCG CCGCAACAAA AGGCTCTAGT TGATCAAGTG
 901 ATCGGAAGTA GGAACCCAGG GATTGCAGAC ATAGAAGACC TAACTCTGCT TGCCAGAAGC
 961 ATGGTAGTTG TCAGACCCTC TGTAGCGAGC AAAGTGGTGC TTCCCATAAG CATTTATGCT
1021 AAAATACCTC AACTAGGATT CAATACCGAA GAATACTCTA TGGTTGGGTA TGAAGCCATG
1081 GCTCTTTATA ATATGGCAAC ACCTGTTTCC ATATTAAGAA TGGGAGATGA CGCAAAAGAT
1141 AAATCTCAAC TATTCTTCAT GTCGTGCTTC GGAGCTGCCT ATGAAGATCT AAGAGTGTTA
1201 TCTGCACTAA CGGGCACCGA ATTTAAGCCT AGATCAGCAC TAAAATGCAA GGGTTTCCAT
1261 GTCCCGGCTA AGGAGCAAGT AGAAGGAATG GGGGCAGCTC TGATGTCCAT CAAGCTTCAG
1321 TTCTGGGCCC CAATGACCAG ATCTGGAGGG AATGAAGTAA GTGGAGAAGG AGGGTCTGGT
1381 CAAATAAGTT GCAGCCCTGT GTTTGCAGTA GAAAGACCTA TTGCTCTAAG CAAGCAAGCT
1441 GTAAGAAGAA TGCTGTCAAT GAACGTTGAA GGACGTGATG CAGATGTCAA AGGAAATCTA
1501 CTCAAAATGA TGAATGATTC AATGGCAAAG AAAACCAGTG GAAATGCTTT CATTGGGAAG
1561 AAAATGTTTC AAATATCAGA CAAAAACAAA GTCAATCCCA TTGAGATTCC AATTAAGCAG
1621 ACCATCCCCA ATTTCTTCTT TGGGAGGGAC ACAGCAGAGG ATTATGATGA CCTCGATTAT
1681 TAA
The amino acid sequence of the NP protein of IBV B/LEE/40, encoded by nucleotides 1-1680 of SEQ ID NO: 15 is as follows, referred to herein as SEQ ID
MSNMDIDSINTGTIDKTPEELTPGTSGATRPIIKPATLAPPSNKRTRNPS
PERTTTSSETDIGRKIQKKQTPTEIKKSVYKMVVKLGEFYNQMMVKAGLN
DDMERNLIQNAQAVERILLAATDDKKTEYQKKRNARDVKEGKEEIDHNKT
GGTFYKMVRDDKTIYFSPIKITFLKEEVKTMYKTTMGSDGFSGLNHIMIG
HSQMNDVCFQRSKGLKRVGLDPSLISTFAGSTLPRRSGTTGVAIKGGGTL
VDEAIRFIGRAMADRGLLRDIKAKTAYEKILLNLKNKCSAPQQKALVDQV
IGSRNPGIADIEDLTLLARSMVVVRPSVASKVVLPISIYAKIPQLGFNTE
EYSMVGYEAMALYNMATPVSILRMGDDAKDKSQLFFMSCFGAAYEDLRVL
SALTGTEFKPRSALKCKGFHVPAKEQVEGMGAALMSIKLQFWAPMTRSGG
NEVSGEGGSGQISCSPVFAVERPIALSKQAVRRMLSMNVEGRDADVKGNL
LKMMNDSMAKKTSGNAFIGKKMFQISDKNKVNPIEIPIKQTIPNFFFGRD
TAEDYDDLDY
Non limiting examples of nucleotide sequences encoding the IAV hemagglutinin (HA) are as follows. It should be noted that HA sequences vary significantly between IV subtypes. Virtually any nucleotide sequence encoding an IV HA is suitable for the present invention. In fact, HA sequences included in vaccines and therapeutic formulations of the present invention (discussed in more detail below) might change from year to year depending on the prevalent strain or strains of IV.
The partial nucleotide sequence of the HA protein of IAV A/New_York/1/18(H1N1) is available as GenBank Accession Number AF116576, and has the following sequence, referred to herein as SEQ ID NO:17:
   1 atggaggcaa gactactggt cttgttatgt gcatttgcag ctacaaatgc agacacaata
  61 tgtataggct accatgcgaa taactcaacc gacactgttg acacagtact cgaaaagaat
 121 gtgaccgtga cacactctgt taacctgctc gaagacagcc acaacggaaa actatgtaaa
 181 ttaaaaggaa tagccccatt acaattgggg aaatgtaata tcgccggatg gctcttggga
 241 aacccggaat gcgatttact gctcacagcg agctcatggt cctatattgt agaaacatcg
 301 aactcagaga atggaacatg ttacccagga gatttcatcg actatgaaga actgagggag
 361 caattgagct cagtgtcatc gtttgaaaaa ttcgaaatat ttcccaagac aagctcgtgg
 421 cccaatcatg aaacaaccaa aggtgtaacg gcagcatgct cctatgcggg agcaagcagt
 481 ttttacagaa atttgctgtg gctgacaaag aagggaagct catacccaaa gcttagcaag
 541 tcctatgtga acaataaagg gaaagaagtc cttgtactat ggggtgttca tcatccgcct
 601 accggtactg atcaacagag tctctatcag aatgcagatg cttatgtctc tgtagggtca
 661 tcaaaatata acaggagatt caccccggaa atagcagcga gacccaaagt aagaggtcaa
 721 gctgggagga tgaactatta ctggacatta ctagaacccg gagacacaat aacatttgag
 781 gcaactggaa atctaatagc accatggtat gctttcgcac tgaatagagg ttctggatcc
 841 ggtatcatca cttcagacgc accagtgcat gattgtaaca cgaagtgtca aacaccccat
 901 ggtgctataa acagcagtct ccctttccag aatatacatc cagtcacaat aggagagtgc
 961 ccaaaatacg tcaggagtac caaattgagg atggctacag gactaagaaa cattccatct
1021 attcaatcca ggggtctatt tggagccatt gccggtttta ttgagggggg atggactgga
1081 atgatagatg gatggtatgg ttatcatcat cagaatgaac agggatcagg ctatgcagcg
1141 gatcaaaaaa gcacacaaaa tgccattgac gggattacaa acaaggtgaa ttctgttatc
1201 gagaaaatga acacccaatt
The amino acid sequence of the partial HA protein of IAV A/New_York/1/18(H1N1), encoded by nucleotides 1 to 1218 of SEQ ID NO:17 is as follows, referred to herein as SEQ ID NO:18:
MEARLLVLLCAFAATNADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLL
EDSHNGKLCKLKGIAPLQLGKCNIAGWLLGNPECDLLLTASSWSYIVETS
NSENGTCYPGDFIDYEELREQLSSVSSFEKFEIFPKTSSWPNIIETTKGV
TAACSYAGASSFYRNLLWLTKKGSSYPKLSKSYVNNKGKEVLVLWGVHHP
PTGTDQQSLYQNADAYVSVGSSKYNRRFTPEIAARLPKVRGQAGRMNYYW
TLLEPGDTITFEATGNLIAPWYAFALNRGSGSGIITSDAPVHDCNTKCQT
PHGAINSSLPFQNIHPVTIGECPKYVRSTKLRMATGLRNIPSIQSRGLFG
AIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNS
VIEKMNTQ
The nucleotide sequence of the IAV A/Hong Kong/482/97 hemagglutinin (H5) is available as GenBank Accession Number AF046098, and has the following sequence, referred to herein as SEQ ID NO:19:
   1 ctgtcaaaat ggagaaaata gtgcttcttc ttgcaacagt cagtcttgtt aaaagtgatc
  61 agatttgcat tggttaccat gcaaacaact cgacagagca ggttgacaca ataatggaaa
 121 agaatgttac tgttacacat gcccaagaca tactggaaag gacacacaac gggaagctct
 181 gcgatctaaa tggagtgaaa cctctcattt tgagggattg tagtgtagct ggatggctcc
 241 tcggaaaccc tatgtgtgac gaattcatca atgtgccgga atggtcttac atagtggaga
 301 aggccagtcc agccaatgac ctctgttatc cagggaattt caacgactat gaagaactga
 361 aacacctatt gagcagaata aaccattttg agaaaattca gatcatcccc aaaagttctt
 421 ggtccaatca tgatgcctca tcaggggtga gctcagcatg tccatacctt gggaggtcct
 481 cctttttcag aaatgtggta tggcttatca aaaagaacag tgcataccca acaataaaga
 541 ggagctacaa taataccaac caagaagatc ttttggtact gtgggggatt caccatccta
 601 atgatgcggc agageagaca aagctctatc aaaatccaac cacctacatt tccgttggaa
 661 catcaacact gaaccagaga ttggttccag aaatagctac tagacccaaa gtaaacgggc
 721 aaagtggaag aatggagttc ttctggacaa ttttaaagcc gaatgatgcc atcaatttcg
 781 agagtaatgg aaatttcatt gccccagaat atgcatacaa aattgtcaag aaaggggact
 841 caacaattat gaaaagtgaa ttggaatatg gtaactgcaa caccaagtgt caaactccaa
 901 tgggggcgat aaactctagt atgccattcc acaacataca ccccctcacc atcggggaat
 961 gccccaaata tgtgaaatca aacagattag ttcttgcgac tggactcaga aatacccctc
1021 aaagggagag aagaagaaaa aagagaggac tatttggagc tatagcaggt tttatagagg
1081 gaggatggca gggcatggta gatggttggt atgggtacca ccatagcaat gagcagggga
1141 gtggatacgc tgcagacaaa gaatccactc aaaaggcaat agatggagtc accaataagg
1201 tcaactcgat cattaacaaa atgaacactc agtttgaggc cgttggaagg gaatttaata
1261 acttagaaag gagaatagag aatttaaaca agaaaatgga agacggattc ctagatgtct
1321 ggacttacaa tgctgaactt ctggttctca tggaaaatga gagaactctc gactttcatg
1381 actcaaatgt caagaacctt tacgacaagg tccgactaca gcttagggat aatgcaaagg
1441 aactgggtaa tggttgtttc gaattctatc acaaatgtga taatgaatgt atggaaagtg
1501 taaaaaacgg aacgtatgac tacccgcagt attcagaaga agcaagacta aacagagagg
1561 aaataagtgg agtaaaattg gaatcaatgg gaacttacca aatactgtca atttattcaa
1621 cagtggcgag ttccctagca ctggcaatca tggtagctgg tctatcttta tggatgtgct
1681 ccaatggatc gttacaatgc agaatttgca tttaaatttg tgagttcaga ttgtagttaa
1741 a
The amino acid sequence of the HA protein of IAV A/Hong Kong/482/97 (H5), encoded by nucleotides 9 to 1715 of SEQ ID NO:19 is as follows, referred to herein as SEQ ID NO:20:
MEKIVLLLATVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILE
RTHNGKLCDLNGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKAS
PANDLCYPGNFNDYEELKLHLLSRINHFEKIQIIPKSSWSNHDASSGVSS
ACPYLGRSSFFRNVVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPND
AAEQTKLYQNPTTYISVGTSTLNQRLVPEIATRPKVNGQSGRMEFFWTIL
KPNDAINFESNGNFIAPEYAYKIVKKGDSTIMKSELEYGNCNTKCQTPMG
AINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNTPQRERRRKKRGLF
GAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVN
SIINKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLME
NERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVK
NGTYDYPQYSEEARLNREEISGVKLESMGTYQILSIYSTVASSLALAIMV
AGLSLWMCSNGSLQCRICI
The nucleotide sequence of the IAV A/Hong Kong/1073/99(H9N2) is available as GenBank Accession Number INA404626, and has the following sequence, referred to herein as SEQ ID NO:21:
   1 gcaaaagcag gggaattact taactagcaa aatggaaaca atatcactaa taactatact
  61 actagtagta acagcaagca atgcagataa aatctgcatc ggccaccagt caacaaactc
 121 cacagaaact gtggacacgc taacagaaac caatgttcct gtgacacatg ccaaagaatt
 181 gctccacaca gagcataatg gaatgctgtg tgcaacaagc ctgggacatc ccctcattct
 241 agacacatgc actattgaag gactagtcta tggcaaccct tcttgtgacc tgctgttggg
 301 aggaagagaa tggtcctaca tcgtcgaaag atcatcagct gtaaatggaa cgtgttaccc
 361 tgggaatgta gaaaacctag aggaactcag gacacttttt agttccgcta gttcctacca
 421 aagaatccaa atcttcccag acacaacctg gaatgtgact tacactggaa caagcagagc
 481 atgttcaggt tcattctaca ggagtatgag atggctgact caaaagagcg gtttttaccc
 541 tgttcaagac gcccaataca caaataacag gggaaagagc attcttttcg tgtggggcat
 601 acatcaccca cccacctata ccgagcaaac aaatttgtac ataagaaacg acacaacaac
 661 aagcgtgaca acagaagatt tgaataggac cttcaaacca gtgatagggc caaggcccct
 721 tgtcaatggt ctgcagggaa gaattgatta ttattggtcg gtactaaaac caggccaaac
 781 attgcgagta cgatccaatg ggaatctaat tgctccatgg tatggacacg ttctttcagg
 841 agggagccat ggaagaatcc tgaagactga tttaaaaggt ggtaattgtg tagtgcaatg
 901 tcagactgaa aaaggtggct taaacagtac attgccattc cacaatatca gtaaatatgc
 961 atttggaacc tgccccaaat atgtaagagt taatagtctc aaactggcag tcggtctgag
1021 gaacgtgcct gctagatcaa gtagaggact atttggagcc atagctggat tcatagaagg
1081 aggttggcca ggactagtcg ctggctggta tggtttccag cattcaaatg atcaaggggt
1141 tggtatggct gcagataggg attcaactca aaaggcaatt gataaaataa catccaaggt
1201 gaataatata gtcgacaaga tgaacaagca atatgaaata attgatcatg aattcagtga
1261 ggttgaaact agactcaata tgatcaataa taagattgat gaccaaatac aagacgtatg
1321 ggcatataat gcagaattgc tagtactact tgaaaatcaa aaaacactcg atgagcatga
1381 tgcgaacgtg aacaatctat ataacaaggt gaagagggca ctgggctcca atgctatgga
1441 agatgggaaa ggctgtttcg agctatacca taaatgtgat gatcagtgca tggaaacaat
1501 tcggaacggg acctataata ggagaaagta tagagaggaa tcaagactag aaaggcagaa
1561 aatagagggg gttaagctgg aatctgaggg aacttacaaa atcctcacca tttattcgac
1621 tgtcgcctca tctcttgtgc ttgcaatggg gtttgctgcc ttcctgttct gggccatgtc
1681 caatggatct tgcagatgca acatttgtat ataa
The amino acid sequence of the HA protein of IAV A/Hong Kong/1073/99 (H9N2), encoded by nucleotides 32 to 1711 of SEQ ID NO:21 is as follows, referred to herein as SEQ ID NO:22:
METISLITILLVVTASNADKICIGHQSTNSTETVDTLTETNVPVTHAKEL
LHTEHNGMLCATSLGHPLILDTCTIEGLVYGNPSCDLLLGGREWSYIVER
SSAVNGTCYPGNVENLEELRTLFSSASSYQRIQIFPDTTWNVTYTGTSRA
CSGSFYRSMRWLTQKSGFYPVQDAQYTNNRGKSILFVWGIHHPPTYTEQT
NLYIRNDTTTSVTTEDLNRTFKPVIGPRPLVNGLQGRIDYYWSVLKPGQT
LRVRSNGNLIAPWYGHVLSGGSHGRILKTDLKGGNCVVQCQTEKGGLNST
LPFHNISKYAFGTCPKYVRVNSLKLAVGLRNVPARSSRGLFGAIAGFIEG
GWPGLVAGWYGFQHSNDQGVGMAADRDSTQKAIDKITSKVNNIVDKMNKQ
YEIIDHEFSEVETRINMINNKIDDQIQDVWAYNAELLVLLENQKTLDEHD
ANVNNLYNKVKRALGSNAMEDGKGCFELYHKCDDQCMETIRNGTYNRRKY
REESRLERQKIEGVKLESEGTYKILTIYSTVASSLVLAMGFAAFLFWAMS
NGSCRCNICI
The present invention also provides vaccine compositions and methods for delivery of IV coding sequences to a vertebrate with optimal expression and safety conferred through codon optimization and/or other manipulations. These vaccine compositions are prepared and administered in such a manner that the encoded gene products are optimally expressed in the vertebrate of interest. As a result, these compositions and methods are useful in stimulating an immune response against IV infection. Also included in the invention are expression systems, delivery systems, and codon-optimized IV coding regions.
In a specific embodiment, the invention provides combinatorial polynucleotide (e.g., DNA) vaccines which combine both a polynucleotide vaccine and polypeptide (e.g., either a recombinant protein, a purified subunit protein, a viral vector expressing an isolated IV polypeptide, or in the form of an inactivated or attenuated IV vaccine) vaccine in a single formulation. The single formulation comprises an IV polypeptide-encoding polynucleotide vaccine as described herein, and optionally, an effective amount of a desired isolated IV polypeptide or fragment, variant, or derivative thereof. The polypeptide may exist in any form, for example, a recombinant protein, a purified subunit protein, a viral vector expressing an isolated IV polypeptide, or in the form of an inactivated or attenuated IV vaccine. The IV polypeptide or fragment, variant, or derivative thereof encoded by the polynucleotide vaccine may be identical to the isolated IV polypeptide or fragment, variant, or derivative thereof. Alternatively, the IV polypeptide or fragment, variant, or derivative thereof encoded by the polynucleotide may be different from the isolated IV polypeptide or fragment, variant, or derivative thereof.
It is to be noted that the term “a” or “an” entity refers to one or more of that entity; for example, “a polynucleotide,” is understood to represent one or more polynucleotides. As such, the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
The term “polynucleotide” is intended to encompass a singular nucleic acid or nucleic acid fragment as well as plural nucleic acids or nucleic acid fragments, and refers to an isolated molecule or construct, e.g., a virus genome (e.g., a non-infectious viral genome), messenger RNA (mRNA), plasmid DNA (pDNA), or derivatives of pDNA (e.g., minicircles as described in (Darquet, A-M et al., Gene Therapy 4:1341-1349 (1997)) comprising a polynucleotide. A polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).
The terms “nucleic acid” or “nucleic acid fragment” refer to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide or construct. A nucleic acid or fragment thereof may be provided in linear (e.g., mRNA) or circular (e.g., plasmid) form as well as double-stranded or single-stranded forms. By “isolated” nucleic acid or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment. For example, a recombinant polynucleotide contained in a vector is considered isolated for the purposes of the present invention. Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution. Isolated RNA molecules include in vivo or in vitro RNA transcripts of the polynucleotides of the present invention. Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically.
As used herein, a “coding region” is a portion of nucleic acid which consists of codons translated into amino acids. Although a “stop codon” (TAG, TGA, or TAA) is not translated into an amino acid, it may be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, and the like, are not part of a coding region. Two or more nucleic acids or nucleic acid fragments of the present invention can be present in a single polynucleotide construct, e.g., on a single plasmid, or in separate polynucleotide constructs, e.g., on separate (different) plasmids. Furthermore, any nucleic acid or nucleic acid fragment may encode a single IV polypeptide or fragment, derivative, or variant thereof, e.g., or may encode more than one polypeptide, e.g., a nucleic acid may encode two or more polypeptides. In addition, a nucleic acid may include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator, or may encode heterologous coding regions fused to the IV coding region, e.g., specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
The terms “fragment,” “variant,” “derivative” and “analog” when referring to IV polypeptides of the present invention include any polypeptides which retain at least some of the immunogenicity or antigenicity of the corresponding native polypeptide. Fragments of IV polypeptides of the present invention include proteolytic fragments, deletion fragments and in particular, fragments of IV polypeptides which exhibit increased secretion from the cell or higher immunogenicity or reduced pathogenicity when delivered to an animal. Polypeptide fragments further include any portion of the polypeptide which comprises an antigenic or immunogenic epitope of the native polypeptide, including linear as well as three-dimensional epitopes. Variants of IV polypeptides of the present invention include fragments as described above, and also polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions. Variants may occur naturally, such as an allelic variant. By an “allelic variant” is intended alternate forms of a gene occupying a given locus on a chromosome or genome of an organism or virus. Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985), which is incorporated herein by reference. For example, as used herein, variations in a given gene product is a “variant”. When referring to IV NA or HA proteins, each such protein is a “variant,” in that native IV strains are distinguished by the type of NA and HA proteins encoded by the virus. However, within a single HA or NA variant type, further naturally or non-naturally occurring variations such as amino acid deletions, insertions or substitutions may occur. Non-naturally occurring variants may be produced using art-known mutagenesis techniques. Variant polypeptides may comprise conservative or non-conservative amino acid substitutions, deletions or additions. Derivatives of IV polypeptides of the present invention, are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Examples include fusion proteins. An analog is another form of an IV polypeptide of the present invention. An example is a proprotein which can be activated by cleavage of the proprotein to produce an active mature polypeptide.
The terms “infectious polynucleotide” or “infectious nucleic acid” are intended to encompass isolated viral polynucleotides and/or nucleic acids which are solely sufficient to mediate the synthesis of complete infectious virus particles upon uptake by permissive cells. Thus, “infectious nucleic acids” do not require pre-synthesized copies of any of the polypeptides it encodes, e.g., viral replicases, in order to initiate its replication cycle in a permissive host cell.
The terms “non-infectious polynucleotide” or “non-infectious nucleic acid” as defined herein are polynucleotides or nucleic acids which cannot, without additional added materials, e.g, polypeptides, mediate the synthesis of complete infectious virus particles upon uptake by permissive cells. An infectious polynucleotide or nucleic acid is not made “non-infectious” simply because it is taken up by a non-permissive cell. For example, an infectious viral polynucleotide from a virus with limited host range is infectious if it is capable of mediating the synthesis of complete infectious virus particles when taken up by cells derived from a permissive host (i.e., a host permissive for the virus itself). The fact that uptake by cells derived from a non-permissive host does not result in the synthesis of complete infectious virus particles does not make the nucleic acid “non-infectious.” In other words, the term is not qualified by the nature of the host cell, the tissue type, or the species taking up the polynucleotide or nucleic acid fragment.
In some cases, an isolated infectious polynucleotide or nucleic acid may produce fully-infectious virus particles in a host cell population which lacks receptors for the virus particles, i.e., is non-permissive for virus entry. Thus viruses produced will not infect surrounding cells. However, if the supernatant containing the virus particles is transferred to cells which are permissive for the virus, infection will take place.
The terms “replicating polynucleotide” or “replicating nucleic acid” are meant to encompass those polynucleotides and/or nucleic acids which, upon being taken up by a permissive host cell, are capable of producing multiple, e.g., one or more copies of the same polynucleotide or nucleic acid. Infectious polynucleotides and nucleic acids are a subset of replicating polynucleotides and nucleic acids; the terms are not synonymous. For example, a defective virus genome lacking the genes for virus coat proteins may replicate, e.g., produce multiple copies of itself, but is NOT infectious because it is incapable of mediating the synthesis of complete infectious virus particles unless the coat proteins, or another nucleic acid encoding the coat proteins, are exogenously provided.
In certain embodiments, the polynucleotide, nucleic acid, or nucleic acid fragment is DNA. In the case of DNA, a polynucleotide comprising a nucleic acid which encodes a polypeptide normally also comprises a promoter and/or other transcription or translation control elements operably associated with the polypeptide-encoding nucleic acid fragment. An operable association is when a nucleic acid fragment encoding a gene product, e.g., a polypeptide, is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory sequence(s). Two DNA fragments (such as a polypeptide-encoding nucleic acid fragment and a promoter associated with the 5′ end of the nucleic acid fragment) are “operably associated” if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the expression regulatory sequences to direct the expression of the gene product, or (3) interfere with the ability of the DNA template to be transcribed. Thus, a promoter region would be operably associated with a nucleic acid fragment encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid fragment. The promoter may be a cell-specific promoter that directs substantial transcription of the DNA only in predetermined cells. Other transcription control elements, besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription. Suitable promoters and other transcription control regions are disclosed herein.
A variety of transcription control regions are known to those skilled in the art. These include, without limitation, transcription control regions which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (the immediate early promoter, in conjunction with intron-A), simian virus 40 (the early promoter), and retroviruses (such as Rous sarcoma virus). Other transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit β-globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue-specific promoters and enhancers as well as lymphokine-inducible promoters (e.g., promoters inducible by interferons or interleukins).
Similarly, a variety of translation control elements are known to those of ordinary skill in the art. These include, but are not limited to ribosome binding sites, translation initiation and termination codons, elements from picornaviruses (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence).
A DNA polynucleotide of the present invention may be a circular or linearized plasmid or vector, or other linear DNA which may also be non-infectious and nonintegrating (i.e., does not integrate into the genome of vertebrate cells). A linearized plasmid is a plasmid that was previously circular but has been linearized, for example, by digestion with a restriction endonuclease. Linear DNA may be advantageous in certain situations as discussed, e.g., in Cherng, J. Y., et al.,

The remainder of this text has been abbreviated because it is either very complex or very long and may not be displayed properly or efficiently by your web browser. Even with this precaution, certain browsers may display odd behaviors when rendering this document. Please download the document to view it in its entirety.
(Source: USPTO)
What is claimed is:
1. An isolated polypeptide produced by a polynucleotide comprising a nucleic acid fragment which encodes the amino acid sequence of SEQ ID NO:76, wherein the codons of said nucleic acid fragment are optimized for expression in humans.
2. The isolated polypeptide of claim 1, wherein said nucleic acid fragment encoding the isolated polypeptide comprises SEQ ID NO:75.
3. An isolated polypeptide comprising the amino acid sequence of SEQ ID NO:76, wherein said polypeptide, upon administration to a vertebrate elicits a detectable immune response against SEQ ID NO:76.
4. The polypeptide of claims 3, further comprising a heterologous polypeptide ligated to said polypeptide.
5. The polypeptide of claim 4, wherein said heterologous polypeptide is hepatitis B core antigen.
6. The polypeptide of claim 5, wherein said hepatitis core antigen comprises at least 50 amino acids of a polypeptide selected from the group consisting of SEQ ID NO:40 and SEQ ID NO:42.
7. The polypeptide of claim 3, wherein said heterologous polypeptide comprises at least the extracellular domain of an influenza virus M2 protein.
8. A composition comprising the polypeptide of claim 1 and an adjuvant.
9. A method of treating or preventing influenza infection in a vertebrate comprising administering to a vertebrate in need thereof the composition of claim 8.
10. A composition comprising the polypeptide of claim 3 and an adjuvant.
11. A method of treating or preventing influenza infection in a vertebrate comprising administering to a vertebrate in need thereof the composition of claim 10.
(Source: USPTO)